Search Antibody, Protein, and ELISA Kit Solutions

MRPS31 Antibody - N-terminal region (ARP62691_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62691_P050-FITC Conjugated

ARP62691_P050-HRP Conjugated

ARP62691_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Mitochondrial ribosomal protein S31
NCBI Gene Id:
Protein Name:
28S ribosomal protein S31, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
IMOGN38, MRP-S31, S31mt
Replacement Item:
This antibody may replace item sc-84211 from Santa Cruz Biotechnology.
Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. The 28S subunit of the mammalian mitoribosome may play a crucial and characteristic role in translation initiation. This gene encodes a 28S subunit protein that has also been associated with type 1 diabetes; however, its relationship to the etiology of this disease remains to be clarified. Pseudogenes corresponding to this gene have been found on chromosomes 3 and 13.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRPS31.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRPS31.
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MRPS31 (ARP62691_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LTVRHGTVRYRSSALLARTKNNIQRYFGTNSVICSKKDKQSVRTEETSKE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MRPS31 (ARP62691_P050) antibody is Catalog # AAP62691
Printable datasheet for anti-MRPS31 (ARP62691_P050) antibody
Sample Type Confirmation:

MRPS31 is strongly supported by BioGPS gene expression data to be expressed in HT1080

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...