Search Antibody, Protein, and ELISA Kit Solutions

MRPS15 antibody - N-terminal region (ARP33299_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33299_P050-FITC Conjugated

ARP33299_P050-HRP Conjugated

ARP33299_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mitochondrial ribosomal protein S15
Protein Name:
28S ribosomal protein S15, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DC37, FLJ11564, MPR-S15, RPMS15, S15mt
Replacement Item:
This antibody may replace item sc-103637, HPA028134
Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRPS15.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRPS15.
The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS15
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 83%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-MRPS15 (ARP33299_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MRPS15 (ARP33299_P050) antibody is Catalog # AAP33299 (Previous Catalog # AAPP04341)
Printable datasheet for anti-MRPS15 (ARP33299_P050) antibody
Sample Type Confirmation:

MRPS15 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Zhang,Z. (2003) Genomics 81 (5), 468-480

Davies, S. M. K. et al. Pentatricopeptide repeat domain protein 3 associates with the mitochondrial small ribosomal subunit and regulates translation. FEBS Lett. 583, 1853-8 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19427859

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...