Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP33299_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33299_P050-FITC Conjugated

ARP33299_P050-HRP Conjugated

ARP33299_P050-Biotin Conjugated

MRPS15 Antibody - N-terminal region (ARP33299_P050)

Catalog#: ARP33299_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-103637, HPA028134
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS15
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 83%; Rabbit: 86%; Rat: 92%
Complete computational species homology data Anti-MRPS15 (ARP33299_P050)
Peptide Sequence Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MRPS15 (ARP33299_P050) antibody is Catalog # AAP33299 (Previous Catalog # AAPP04341)
Datasheets/Manuals Printable datasheet for anti-MRPS15 (ARP33299_P050) antibody
Sample Type Confirmation

MRPS15 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference Zhang,Z. (2003) Genomics 81 (5), 468-480
Publications

Davies, S. M. K. et al. Pentatricopeptide repeat domain protein 3 associates with the mitochondrial small ribosomal subunit and regulates translation. FEBS Lett. 583, 1853-8 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19427859

Gene Symbol MRPS15
Official Gene Full Name Mitochondrial ribosomal protein S15
Alias Symbols DC37, FLJ11564, MPR-S15, RPMS15, S15mt
NCBI Gene Id 64960
Protein Name 28S ribosomal protein S15, mitochondrial
Description of Target Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS15 is a 28S subunit protein that belongs to the ribosomal protein S15P family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S15P family. The encoded protein is more than two times the size of its E. coli counterpart, with the 12S rRNA binding sites conserved. Between human and mouse, the encoded protein is the least conserved among small subunit ribosomal proteins. Pseudogenes corresponding to this gene are found on chromosomes 15q and 19q.
Swissprot Id P82914
Protein Accession # NP_112570
Nucleotide Accession # NM_031280
Protein Size (# AA) 257
Molecular Weight 30kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MRPS15.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MRPS15.
Protein Interactions GRSF1; UBC; PARK2; ESR2; PTCD3; CAND1; COPS5; CUL3; SUMO2; ICT1;
  1. What is the species homology for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPS15 Antibody - N-terminal region (ARP33299_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    This target may also be called "DC37, FLJ11564, MPR-S15, RPMS15, S15mt" in publications.

  5. What is the shipping cost for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "30kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPS15 Antibody - N-terminal region (ARP33299_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MRPS15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPS15"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPS15"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPS15"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPS15"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPS15"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPS15 Antibody - N-terminal region (ARP33299_P050)
Your Rating