Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP60476_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60476_P050-FITC Conjugated

ARP60476_P050-HRP Conjugated

ARP60476_P050-Biotin Conjugated

MRPL45 Antibody - C-terminal region (ARP60476_P050)

Catalog#: ARP60476_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Human, Mouse, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-515563 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MRPL45
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 75%; Human: 100%; Mouse: 91%; Rat: 82%; Zebrafish: 75%
Complete computational species homology dataAnti-MRPL45 (ARP60476_P050)
Peptide SequenceSynthetic peptide located within the following region: YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MRPL45 (ARP60476_P050) antibody is Catalog # AAP60476 (Previous Catalog # AAPP46770)
Datasheets/ManualsPrintable datasheet for anti-MRPL45 (ARP60476_P050) antibody
Publications

Kotani, T., Akabane, S., Takeyasu, K., Ueda, T. & Takeuchi, N. Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes. Nucleic Acids Res. 41, 3713-22 (2013). WB, Cow, Human, Mouse, Rat, Zebrafish 23396448

Gene SymbolMRPL45
Official Gene Full NameMitochondrial ribosomal protein L45
Alias SymbolsMGC11321, L45mt, MRP-L45
NCBI Gene Id84311
Protein Name39S ribosomal protein L45, mitochondrial
Description of TargetMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 2p and 17q.
Swissprot IdQ9BRJ2
Protein Accession #NP_115727
Nucleotide Accession #NM_032351
Protein Size (# AA)306
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MRPL45.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MRPL45.
Protein InteractionsTRIM23; UBC; C1QBP; TMEM177; MRPL24; MARCKSL1; MRPL9; MRPL11; MRPL32; MRPL38; MRPL47; SYNJ2BP; MRPL50; MRPL51; MRPL37; MRPL15; MRPL13; ZC3H4; HNRNPR; MRPL19; SDHB; ILF3; CUL3; ICT1; KBTBD7; G3BP1;
Write Your Own Review
You're reviewing:MRPL45 Antibody - C-terminal region (ARP60476_P050)
Your Rating
Aviva HIS tag Deal
Aviva ChIP Antibodies
Assay Development
Aviva Tissue Tool