Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60476_P050-FITC Conjugated

ARP60476_P050-HRP Conjugated

ARP60476_P050-Biotin Conjugated

MRPL45 Antibody - C-terminal region (ARP60476_P050)

Catalog#: ARP60476_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Human, Mouse, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-515563 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL45
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 75%; Human: 100%; Mouse: 91%; Rat: 82%; Zebrafish: 75%
Complete computational species homology data Anti-MRPL45 (ARP60476_P050)
Peptide Sequence Synthetic peptide located within the following region: YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MRPL45 (ARP60476_P050) antibody is Catalog # AAP60476 (Previous Catalog # AAPP46770)
Datasheets/Manuals Printable datasheet for anti-MRPL45 (ARP60476_P050) antibody

Kotani, T., Akabane, S., Takeyasu, K., Ueda, T. & Takeuchi, N. Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes. Nucleic Acids Res. 41, 3713-22 (2013). WB, Cow, Human, Mouse, Rat, Zebrafish 23396448

Gene Symbol MRPL45
Official Gene Full Name Mitochondrial ribosomal protein L45
Alias Symbols MGC11321, L45mt, MRP-L45
NCBI Gene Id 84311
Protein Name 39S ribosomal protein L45, mitochondrial
Description of Target Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 2p and 17q.
Swissprot Id Q9BRJ2
Protein Accession # NP_115727
Nucleotide Accession # NM_032351
Protein Size (# AA) 306
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MRPL45.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MRPL45.
Protein Interactions TRIM23; UBC; C1QBP; TMEM177; MRPL24; MARCKSL1; MRPL9; MRPL11; MRPL32; MRPL38; MRPL47; SYNJ2BP; MRPL50; MRPL51; MRPL37; MRPL15; MRPL13; ZC3H4; HNRNPR; MRPL19; SDHB; ILF3; CUL3; ICT1; KBTBD7; G3BP1;
  1. What is the species homology for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Human, Mouse, Rat, Zebrafish".

  2. How long will it take to receive "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPL45 Antibody - C-terminal region (ARP60476_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    This target may also be called "MGC11321, L45mt, MRP-L45" in publications.

  5. What is the shipping cost for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPL45 Antibody - C-terminal region (ARP60476_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MRPL45"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPL45"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPL45"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPL45"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPL45"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPL45"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPL45 Antibody - C-terminal region (ARP60476_P050)
Your Rating