Search Antibody, Protein, and ELISA Kit Solutions

MRPL45 Antibody - C-terminal region (ARP60476_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60476_P050-FITC Conjugated

ARP60476_P050-HRP Conjugated

ARP60476_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Human, Mouse, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MRPL45
Official Gene Full Name:
Mitochondrial ribosomal protein L45
NCBI Gene Id:
84311
Protein Name:
39S ribosomal protein L45, mitochondrial
Swissprot Id:
Q9BRJ2
Protein Accession #:
NP_115727
Nucleotide Accession #:
NM_032351
Alias Symbols:
MGC11321, L45mt, MRP-L45
Replacement Item:
This antibody may replace item sc-515563 from Santa Cruz Biotechnology.
Description of Target:
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 2p and 17q.
Protein Size (# AA):
306
Molecular Weight:
35kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRPL45.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRPL45.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MRPL45
Predicted Homology Based on Immunogen Sequence:
Cow: 75%; Human: 100%; Mouse: 91%; Rat: 82%; Zebrafish: 75%
Complete computational species homology data:
Anti-MRPL45 (ARP60476_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YGSWRMHTKIVPPWAPPKQPILKTVMIPGPQLKPEEEYEEAQGEAQKPQL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
TRIM23; UBC; C1QBP; TMEM177; MRPL24; MARCKSL1; MRPL9; MRPL11; MRPL32; MRPL38; MRPL47; SYNJ2BP; MRPL50; MRPL51; MRPL37; MRPL15; MRPL13; ZC3H4; HNRNPR; MRPL19; SDHB; ILF3; CUL3; ICT1; KBTBD7; G3BP1;
Blocking Peptide:
For anti-MRPL45 (ARP60476_P050) antibody is Catalog # AAP60476 (Previous Catalog # AAPP46770)
Datasheets/Manuals:
Printable datasheet for anti-MRPL45 (ARP60476_P050) antibody
Publications:

Kotani, T., Akabane, S., Takeyasu, K., Ueda, T. & Takeuchi, N. Human G-proteins, ObgH1 and Mtg1, associate with the large mitochondrial ribosome subunit and are involved in translation and assembly of respiratory complexes. Nucleic Acids Res. 41, 3713-22 (2013). WB, Cow, Human, Mouse, Rat, Zebrafish 23396448

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...