MRPL37 Antibody - N-terminal region (ARP56924_P050)

Catalog No: ARP56924_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-MRPL37 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPL37
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MRPL37 (ARP56924_P050) antibody is Catalog # AAP56924 (Previous Catalog # AAPP39115)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: MRPL37
• Gene Full Name: Mitochondrial ribosomal protein L37
• Alias Symbols: L2mt, L37mt, MRPL2, RPML2, MRP-L2, MRP-L37
• NCBI Gene Id: 51253
• Protein Name: 39S ribosomal protein L37, mitochondrial
• Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
• Uniprot ID: Q9BZE1
• Protein Accession #: NP_057575
• Nucleotide Accession #: NM_016491
• Protein Size (# AA): 423
• Molecular Weight: 48kDa
• Protein Interactions: UBC; NEDD8; NPM1; MRPL45; MRPL24; MRPL44; MRPL9; MRPL32; MRPL38; MRPL40; MRPL41; TSR1; MRPL50; MRPL39; MRPL51; MRPL2; MRPL42; FAF2; MRPL12; HNRNPM; DLD; ABCC2; CUL3; TCF3; TK1; SMN1; ICT1; HNRNPA1;