Catalog No: ARP52830_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MRPL10 Antibody - N-terminal region (ARP52830_P050)

Datasheets/ManualsPrintable datasheet for anti-MRPL10 (ARP52830_P050) antibody
Product Info
ReferenceWang,C.C., (2004) Biochem. Biophys. Res. Commun. 314 (2), 335-350
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MRPL10
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 83%; Guinea Pig: 77%; Horse: 83%; Human: 100%; Mouse: 85%; Pig: 85%; Rabbit: 92%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE
Concentration0.5 mg/ml
Blocking PeptideFor anti-MRPL10 (ARP52830_P050) antibody is Catalog # AAP52830 (Previous Catalog # AAPP33838)
Gene SymbolMRPL10
Gene Full NameMitochondrial ribosomal protein L10
Alias SymbolsL10MT, MRPL8, RPML8, MRP-L8, MRP-L10
NCBI Gene Id124995
Protein Name39S ribosomal protein L10, mitochondrial
Description of TargetMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q. Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q.
Uniprot IDQ7Z7H8
Protein Accession #NP_660298
Nucleotide Accession #NM_145255
Protein Size (# AA)261
Molecular Weight29kDa
Protein InteractionsFAM9B; KLHL12; PNMA1; TCF4; REL; UBC; NPM1; MRPL1; MRPL11; MRPL41; MRPL15; MRPL13; MRPL3; MRPL12; MRPL23; SLC25A3; ILF3; ICT1; HNRNPU; ABCC2; BCS1L; APP; ABCB7; MRPL10; USP22;
  1. What is the species homology for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MRPL10 Antibody - N-terminal region (ARP52830_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    This target may also be called "L10MT, MRPL8, RPML8, MRP-L8, MRP-L10" in publications.

  5. What is the shipping cost for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MRPL10 Antibody - N-terminal region (ARP52830_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MRPL10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MRPL10"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MRPL10"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MRPL10"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MRPL10"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MRPL10"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MRPL10 Antibody - N-terminal region (ARP52830_P050)
Your Rating
We found other products you might like!