Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60588_P050-FITC Conjugated

ARP60588_P050-HRP Conjugated

ARP60588_P050-Biotin Conjugated

MRO Antibody - C-terminal region (ARP60588_P050)

Catalog#: ARP60588_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-134943 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MRO
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 90%; Rabbit: 85%; Rat: 77%
Complete computational species homology dataAnti-MRO (ARP60588_P050)
Peptide SequenceSynthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MRO (ARP60588_P050) antibody is Catalog # AAP60588 (Previous Catalog # AAPP46628)
Datasheets/ManualsPrintable datasheet for anti-MRO (ARP60588_P050) antibody

Kenigsberg, S; Lima, PD; Maghen, L; Wyse, BA; Lackan, C; Cheung, AN; Tsang, BK; Librach, CL; The elusive MAESTRO gene: Its human reproductive tissue-specific expression pattern. 12, e0174873 (2017). WB, Cow, Dog, Horse, Human, Mouse, Rabbit, Rat 28406912

Gene SymbolMRO
Official Gene Full NameMaestro
Alias SymbolsB29, C18orf3, FLJ30140
NCBI Gene Id83876
Protein NameProtein maestro Ensembl ENSP00000397900
Description of TargetThis gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination.
Swissprot IdE9PAT5
Protein Accession #NP_001120648
Nucleotide Accession #NM_001127176
Protein Size (# AA)262
Molecular Weight30kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MRO.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MRO.
Write Your Own Review
You're reviewing:MRO Antibody - C-terminal region (ARP60588_P050)
Your Rating
Aviva Travel Grant
Free Microscope
Aviva Live Chat
Aviva Blast Tool