MRKA Recombinant Protein (Klebsiella pneumoniae) (OPCA04498)

Catalog No: OPCA04498

Product Info

• Predicted Species Reactivity: Klebsiella oxytoca|Klebsiella pneumoniae
• Product Format: Lyophilized 10mM Tris-HCl, 1mM EDTA, 6% Trehalose (pH 8.0)
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length of Mature Protein: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ
• Source: E.coli
• Protein Range: 23-202 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Molecular characterization of the type 3 (MR/K) fimbriae of Klebsiella pneumoniae.Gerlach G.-F., Allen B.L., Clegg S.J. Bacteriol. 170:3547-3553(1988)

Target Info

• Gene Symbol: AB185_RS12115
• Gene Full Name: type 1 fimbrial protein
• Alias Symbols: AB185_12090;AB185_RS12115;type 1 fimbrial protein.
• NCBI Gene Id: 29381281
• Protein Name: Fimbrial subunit type 3
• Uniprot ID: P12267
• Protein Accession #: WP_001493056
• Nucleotide Accession #: NZ_MCGW01000029
• Protein Size (# AA): Recombinant
• Molecular Weight: 34.5 kDa