SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP84140_P050
Price: $0.00
SKU
ARP84140_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MR1 (ARP84140_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of Human MR1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: PEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGW
Concentration0.5 mg/ml
Blocking PeptideFor anti-MR1 (ARP84140_P050) antibody is Catalog # AAP84140
Gene SymbolMR1
Gene Full Namemajor histocompatibility complex, class I-related
Alias SymbolsHLALS
NCBI Gene Id3140
Protein Namemajor histocompatibility complex class I-related gene protein
Description of TargetMAIT (mucosal-associated invariant T-cells) lymphocytes represent a small population of T-cells primarily found in the gut. The protein encoded by this gene is an antigen-presenting molecule that presents metabolites of microbial vitamin B to MAITs. This presentation may activate the MAITs to regulate the amounts of specific types of bacteria in the gut. Several transcript variants encoding different isoforms have been found for this gene, and a pseudogene of it has been detected about 36 kbp upstream on the same chromosome.
Uniprot IDQ95460-2
Protein Accession #NP_001181928.1
Nucleotide Accession #NM_001194999.1
Protein Size (# AA)296
Molecular Weight32 kDa
  1. What is the species homology for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "MR1 Antibody - N-terminal region (ARP84140_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    This target may also be called "HLALS" in publications.

  5. What is the shipping cost for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "32 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MR1 Antibody - N-terminal region (ARP84140_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MR1 Antibody - N-terminal region (ARP84140_P050)
Your Rating
We found other products you might like!