Search Antibody, Protein, and ELISA Kit Solutions

MPV17 Antibody - C-terminal region : FITC (ARP73712_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73712_P050 Unconjugated

ARP73712_P050-HRP Conjugated

ARP73712_P050-Biotin Conjugated

Gene Symbol:
MPV17
NCBI Gene Id:
4358
Swissprot Id:
P39210
Protein Accession #:
XP_005264383
Alias Symbols:
MPV17,
Replacement Item:
This antibody may replace item sc-109551 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS).
Protein Size (# AA):
176
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MPV17.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MPV17.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPV17
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
PEX5; MRPL13; SCFD1; PUF60; FAM3C; HNRNPR; MSLN; ATP6V1F; GPRC5A; LAMTOR3; VDAC2; UQCRH; UQCRFS1; RPS15; MRPL23; RALA; ABCD3; NDUFS8; NDUFS6; NDUFB9; HNRNPL; EGFR; CD55; RHOA; NDUFS7; MMGT1; SFXN3; MRPL44; MRPL11; MRPL32; MRPL38; MRPL40; MRPS14; MRPL17; N
Blocking Peptide:
For anti-MPV17 (ARP73712_P050-FITC) antibody is Catalog # AAP73712
Datasheets/Manuals:
Printable datasheet for anti-MPV17 (ARP73712_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...