Search Antibody, Protein, and ELISA Kit Solutions

mpt64 Recombinant Protein (OPCA02937)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Product Format:
Liquid
Host:
Mycobacterium tuberculosis
Reconstitution and Storage:
Store at -20C. Avoid freeze thaw cycles.
Swissprot Id:
P0A5Q4
Molecular Weight:
24 kDa
Formulation:
20 mM Tris-HCl based buffer, pH 8.0
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Storage Buffer:
20 mM Tris-HCl based buffer, pH 8.0
Source:
Yeast
Tag:
His-tag
Datasheets/Manuals:
Printable datasheet for mpt64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA02937)

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...