$0.00
In Stock
SKU
OPCA02937
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

mpt64 Recombinant Protein (OPCA02937)

Catalog#: OPCA02937
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Product Format Liquid
Host Mycobacterium tuberculosis
Reconstitution and Storage Store at -20C. Avoid freeze thaw cycles.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Purity Greater than 90% as determined by SDS-PAGE.
Protein Sequence APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Storage Buffer 20 mM Tris-HCl based buffer, pH 8.0
Source Yeast
Tag His-tag
Datasheets/Manuals Printable datasheet for mpt64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA02937)
Swissprot Id P0A5Q4
Molecular Weight 24 kDa
Write Your Own Review
You're reviewing:mpt64 Recombinant Protein (OPCA02937)
Your Rating
We found other products you might like!