MPT64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA05152)

Catalog No: OPCA05152

Product Info

• Predicted Species Reactivity: Mycobacterium tuberculosis
• Product Format: Lyophilized 20mM Tris-HCl, 0.5M NaCl, 6% Trehalose (pH 8.0)
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length of Mature Protein: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
• Source: E. Coli
• Tag: N-terminal 6xHis-tagged
• Reference: High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets. Harth G., Lee B.Y., Horwitz M.A. Infect. Immun. 65:2321-2328(1997)

Target Info

• Gene Symbol: MPT64
• Alias Symbols: Antigen MPT64
• Protein Name: mpt64
• Uniprot ID: P9WIN9
• Protein Size (# AA): 24-228 aa
• Molecular Weight: 26.4 kDa