$0.00
In Stock
SKU
OPCA05152
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

mpt64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA05152)

Catalog#: OPCA05152
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Mycobacterium tuberculosis
Product Format Liquid
Additional Information Species Specificity Detail: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Reconstitution and Storage Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Formulation Tris-base, 50% glycerol
Purity Greater than 90% as determined by SDS-PAGE.
Protein Sequence Full Length: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Storage Buffer Tris-base, 50% glycerol
Source E.coli
Tag N-terminal 6xHis-tagged
Target Reference High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets.
Harth G., Lee B.Y., Horwitz M.A.
Infect. Immun. 65:2321-2328(1997)
Datasheets/Manuals Printable datasheet for OPCA05152
Gene Symbol mpt64
Alias Symbols Antigen MPT64
Protein Name mpt64
Swissprot Id P0A5Q4
Molecular Weight 26 kDa
Write Your Own Review
You're reviewing:mpt64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA05152)
Your Rating
We found other products you might like!