Search Antibody, Protein, and ELISA Kit Solutions

mpt64 Recombinant Protein (Mycobacterium tuberculosis) (OPCA05152)

* Required Fields

$0.00
In Stock
Request Bulk Order Quote

Predicted Species Reactivity:
Mycobacterium tuberculosis
Product Format:
Liquid
Additional Information:
Species Specificity Detail: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Reconstitution and Storage:
Store at -20/-80C for 12 months. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Symbol:
mpt64
Alias Symbols:
Antigen MPT64
Protein Name:
mpt64
Swissprot Id:
P0A5Q4
Molecular Weight:
26 kDa
Formulation:
Tris-base, 50% glycerol
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
Full Length: APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA
Storage Buffer:
Tris-base, 50% glycerol
Source:
E.coli
Tag:
N-terminal 6xHis-tagged
Target Reference:
High-level heterologous expression and secretion in rapidly growing nonpathogenic mycobacteria of four major Mycobacterium tuberculosis extracellular proteins considered to be leading vaccine candidates and drug targets.
Harth G., Lee B.Y., Horwitz M.A.
Infect. Immun. 65:2321-2328(1997)
Datasheets/Manuals:
Printable datasheet for OPCA05152

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...