Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP48394_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48394_P050-FITC Conjugated

ARP48394_P050-HRP Conjugated

ARP48394_P050-Biotin Conjugated

MPST Antibody - middle region (ARP48394_P050)

Catalog#: ARP48394_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-292174 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MPST
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology dataAnti-MPST (ARP48394_P050)
Peptide SequenceSynthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MPST (ARP48394_P050) antibody is Catalog # AAP48394 (Previous Catalog # AAPP35724)
Datasheets/ManualsPrintable datasheet for anti-MPST (ARP48394_P050) antibody
Sample Type Confirmation

MPST is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceHuang,S.H., (2006) Toxicol. Lett. 165 (2), 101-111
Publications

Cui, X; Navneet, S; Wang, J; Roon, P; Chen, W; Xian, M; Smith, SB; Analysis of MTHFR, CBS, Glutathione, Taurine, and Hydrogen Sulfide Levels in Retinas of Hyperhomocysteinemic Mice. 58, 1954-1963 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28384716

Otani, S; Nagaoka, T; Omae, T; Tanano, I; Kamiya, T; Ono, S; Hein, TW; Kuo, L; Yoshida, A; Histamine-Induced Dilation of Isolated Porcine Retinal Arterioles: Role of Endothelium-Derived Hyperpolarizing Factor. 57, 4791-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27618417

Gene SymbolMPST
Official Gene Full NameMercaptopyruvate sulfurtransferase
Alias SymbolsMGC24539, MST, TST2
NCBI Gene Id4357
Protein Name3-mercaptopyruvate sulfurtransferase
Description of TargetMPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Swissprot IdP25325
Protein Accession #NP_066949
Nucleotide Accession #NM_021126
Protein Size (# AA)297
Molecular Weight33kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MPST.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MPST.
Protein InteractionsUBC; NEDD8; TMEM189; S100A16; NADK2; SEPT11; TIMM9; YKT6; SEC22B; VAPB; UQCRFS1; UPP1; TPI1; NDUFV1; ANXA4; RAE1;
Write Your Own Review
You're reviewing:MPST Antibody - middle region (ARP48394_P050)
Your Rating
Free Microscope
Aviva Tissue Tool
Aviva Blast Tool
Aviva Validation Data