Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP48394_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48394_P050-FITC Conjugated

ARP48394_P050-HRP Conjugated

ARP48394_P050-Biotin Conjugated

MPST Antibody - middle region (ARP48394_P050)

Catalog#: ARP48394_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-292174 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MPST
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data Anti-MPST (ARP48394_P050)
Peptide Sequence Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MPST (ARP48394_P050) antibody is Catalog # AAP48394 (Previous Catalog # AAPP35724)
Datasheets/Manuals Printable datasheet for anti-MPST (ARP48394_P050) antibody
Sample Type Confirmation

MPST is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference Huang,S.H., (2006) Toxicol. Lett. 165 (2), 101-111
Publications

Cui, X; Navneet, S; Wang, J; Roon, P; Chen, W; Xian, M; Smith, SB; Analysis of MTHFR, CBS, Glutathione, Taurine, and Hydrogen Sulfide Levels in Retinas of Hyperhomocysteinemic Mice. 58, 1954-1963 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28384716

Otani, S; Nagaoka, T; Omae, T; Tanano, I; Kamiya, T; Ono, S; Hein, TW; Kuo, L; Yoshida, A; Histamine-Induced Dilation of Isolated Porcine Retinal Arterioles: Role of Endothelium-Derived Hyperpolarizing Factor. 57, 4791-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27618417

Gene Symbol MPST
Official Gene Full Name Mercaptopyruvate sulfurtransferase
Alias Symbols MGC24539, MST, TST2
NCBI Gene Id 4357
Protein Name 3-mercaptopyruvate sulfurtransferase
Description of Target MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Swissprot Id P25325
Protein Accession # NP_066949
Nucleotide Accession # NM_021126
Protein Size (# AA) 297
Molecular Weight 33kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MPST.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MPST.
Protein Interactions UBC; NEDD8; TMEM189; S100A16; NADK2; SEPT11; TIMM9; YKT6; SEC22B; VAPB; UQCRFS1; UPP1; TPI1; NDUFV1; ANXA4; RAE1;
  1. What is the species homology for "MPST Antibody - middle region (ARP48394_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat".

  2. How long will it take to receive "MPST Antibody - middle region (ARP48394_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MPST Antibody - middle region (ARP48394_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MPST Antibody - middle region (ARP48394_P050)"?

    This target may also be called "MGC24539, MST, TST2" in publications.

  5. What is the shipping cost for "MPST Antibody - middle region (ARP48394_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MPST Antibody - middle region (ARP48394_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MPST Antibody - middle region (ARP48394_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MPST Antibody - middle region (ARP48394_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MPST"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MPST"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MPST"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MPST"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MPST"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MPST"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MPST Antibody - middle region (ARP48394_P050)
Your Rating
We found other products you might like!