Search Antibody, Protein, and ELISA Kit Solutions

MPST Antibody - middle region (ARP48394_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48394_P050-FITC Conjugated

ARP48394_P050-HRP Conjugated

ARP48394_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Mercaptopyruvate sulfurtransferase
NCBI Gene Id:
Protein Name:
3-mercaptopyruvate sulfurtransferase
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC24539, MST, TST2
Replacement Item:
This antibody may replace item sc-292174 from Santa Cruz Biotechnology.
Description of Target:
MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis.This gene encodes a protein which can function as a monomer or as a disulfide-linked homodimer and which catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cyanide degradation and in thiosulfate biosynthesis. The encoded cytoplasmic protein is a member of the rhodanese family but is not rhodanese itself, which is a mitochondrial protein. Alternatively spliced transcript variants encoding the same protein have been identified.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MPST.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MPST.
The immunogen is a synthetic peptide directed towards the middle region of human MPST
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%
Complete computational species homology data:
Anti-MPST (ARP48394_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MPST (ARP48394_P050) antibody is Catalog # AAP48394 (Previous Catalog # AAPP35724)
Printable datasheet for anti-MPST (ARP48394_P050) antibody
Sample Type Confirmation:

MPST is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Huang,S.H., (2006) Toxicol. Lett. 165 (2), 101-111

Cui, X; Navneet, S; Wang, J; Roon, P; Chen, W; Xian, M; Smith, SB; Analysis of MTHFR, CBS, Glutathione, Taurine, and Hydrogen Sulfide Levels in Retinas of Hyperhomocysteinemic Mice. 58, 1954-1963 (2017). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28384716

Otani, S; Nagaoka, T; Omae, T; Tanano, I; Kamiya, T; Ono, S; Hein, TW; Kuo, L; Yoshida, A; Histamine-Induced Dilation of Isolated Porcine Retinal Arterioles: Role of Endothelium-Derived Hyperpolarizing Factor. 57, 4791-8 (2016). WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27618417

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...