Catalog No: ARP53247_P050
Price: $0.00
SKU
ARP53247_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MPP7 Antibody - N-terminal region (ARP53247_P050)

Datasheets/ManualsPrintable datasheet for anti-MPP7 (ARP53247_P050) antibody
Product Info
ReferenceStucke,V.M., (2007) Mol. Biol. Cell 18 (5), 1744-1755
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MPP7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWDMFGEKSLHSL
Concentration0.5 mg/ml
Blocking PeptideFor anti-MPP7 (ARP53247_P050) antibody is Catalog # AAP53247 (Previous Catalog # AAPP30730)
Gene SymbolMPP7
Gene Full NameMembrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7)
Alias SymbolsFLJ32798, RP11-218D6.5
NCBI Gene Id143098
Protein NameMAGUK p55 subfamily member 7
Description of TargetMPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]).[supplied by OMIM].
Uniprot IDQ5T2T1
Protein Accession #NP_775767
Nucleotide Accession #NM_173496
Protein Size (# AA)576
Molecular Weight65kDa
Protein InteractionsAMOT; Wwtr1; Yap1; UBC;
  1. What is the species homology for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Rabbit".

  2. How long will it take to receive "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MPP7 Antibody - N-terminal region (ARP53247_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    This target may also be called "FLJ32798, RP11-218D6.5" in publications.

  5. What is the shipping cost for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MPP7 Antibody - N-terminal region (ARP53247_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MPP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MPP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MPP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MPP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MPP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MPP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MPP7 Antibody - N-terminal region (ARP53247_P050)
Your Rating