Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP74070_P050 Unconjugated

ARP74070_P050-HRP Conjugated

ARP74070_P050-Biotin Conjugated

MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)

Catalog#: ARP74070_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human EM55
Purification Affinity Purified
Peptide Sequence Synthetic peptide located within the following region: PVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTK
Concentration 0.5 mg/ml
Blocking Peptide For anti-MPP1 (ARP74070_P050-FITC) antibody is Catalog # AAP74070
Datasheets/Manuals Printable datasheet for anti-MPP1 (ARP74070_P050-FITC) antibody
Gene Symbol MPP1
Official Gene Full Name membrane palmitoylated protein 1
Alias Symbols MRG1, PEMP, AAG12, EMP55, DXS552E
NCBI Gene Id 4354
Protein Name 55 kDa erythrocyte membrane protein
Description of Target This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q00013
Protein Accession # NP_002427
Protein Size (# AA) 466
Molecular Weight 51kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MPP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MPP1.
  1. What is the species homology for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    This target may also be called "MRG1, PEMP, AAG12, EMP55, DXS552E" in publications.

  5. What is the shipping cost for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "51kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MPP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MPP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MPP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MPP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MPP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MPP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MPP1 Antibody - C-terminal region : FITC (ARP74070_P050-FITC)
Your Rating