Search Antibody, Protein, and ELISA Kit Solutions

MPP1 Antibody - C-terminal region (ARP74070_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74070_P050-FITC Conjugated

ARP74070_P050-HRP Conjugated

ARP74070_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MPP1
Official Gene Full Name:
membrane palmitoylated protein 1
NCBI Gene Id:
4354
Protein Name:
55 kDa erythrocyte membrane protein
Swissprot Id:
Q00013
Protein Accession #:
NP_002427
Alias Symbols:
MRG1, PEMP, AAG12, EMP55, DXS552E
Description of Target:
This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
466
Molecular Weight:
51kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MPP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MPP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human EM55
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PVPYTTRPPRKSEEDGKEYHFISTEEMTRNISANEFLEFGSYQGNMFGTK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KLHL12; DNPEP; UBC; HNRNPD; ERBB2IP; FN1; NR1H2; TK1; STK3; SMN1; RPS6KA1; GSK3B; GADD45A; ZAK; RPS6KA6; OPTN; AMOTL2; SGSM2; STUB1; GYPC; ATP5C1;
Blocking Peptide:
For anti-MPP1 (ARP74070_P050) antibody is Catalog # AAP74070
Datasheets/Manuals:
Printable datasheet for anti-MPP1 (ARP74070_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...