Size:100 ul
$229.00
In Stock
SKU
ARP32832_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32832_T100-FITC Conjugated

ARP32832_T100-HRP Conjugated

ARP32832_T100-Biotin Conjugated

MORF4L1 Antibody - middle region (ARP32832_T100)

Catalog#: ARP32832_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-121745 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MORF4L1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-MORF4L1 (ARP32832_T100)
Peptide SequenceSynthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MORF4L1 (ARP32832_T100) antibody is Catalog # AAP32832 (Previous Catalog # AAPP03851)
Datasheets/ManualsPrintable datasheet for anti-MORF4L1 (ARP32832_T100) antibody
Target ReferenceBertram M.J., et al., (1999) Mol. Cell. Biol. 19:1479-1485
Publications

Xie, L. et al. KDM5B regulates embryonic stem cell self-renewal and represses cryptic intragenic transcription. EMBO J. 30, 1473-84 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21448134

Gene SymbolMORF4L1
Official Gene Full NameMortality factor 4 like 1
Alias SymbolsEaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15
NCBI Gene Id10933
Protein NameMortality factor 4-like protein 1
Description of TargetMORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.
Swissprot IdQ86YT7
Protein Size (# AA)362
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MORF4L1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MORF4L1.
Protein InteractionsIKZF1; TNIP1; FXR2; TNNT1; TFCP2; REL; NAB2; MEOX1; GOLGA2; CAMK2B; CEP57L1; BEND7; ZBTB9; FAM9B; MRFAP1L1; MRFAP1; TRIM41; NAV2; L3MBTL3; LZTS2; HMBOX1; ZBTB10; GMCL1; PHF12; ARRDC3; PBXIP1; MRGBP; THAP1; RACGAP1; MORF4L1; PALB2; UBC; MPG; RUVBL2; APP; H
Write Your Own Review
You're reviewing:MORF4L1 Antibody - middle region (ARP32832_T100)
Your Rating
Aviva Tissue Tool
Aviva Validation Data
Assay Development
Aviva Blast Tool