Search Antibody, Protein, and ELISA Kit Solutions

MORF4L1 Antibody - middle region (ARP32832_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32832_T100-FITC Conjugated

ARP32832_T100-HRP Conjugated

ARP32832_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-121745 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human MORF4L1
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MORF4L1 (ARP32832_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MORF4L1 (ARP32832_T100) antibody is Catalog # AAP32832 (Previous Catalog # AAPP03851)
Printable datasheet for anti-MORF4L1 (ARP32832_T100) antibody
Target Reference:
Bertram M.J., et al., (1999) Mol. Cell. Biol. 19:1479-1485

Xie, L. et al. KDM5B regulates embryonic stem cell self-renewal and represses cryptic intragenic transcription. EMBO J. 30, 1473-84 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21448134

Gene Symbol:
Official Gene Full Name:
Mortality factor 4 like 1
Alias Symbols:
Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15
NCBI Gene Id:
Protein Name:
Mortality factor 4-like protein 1
Description of Target:
MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.
Swissprot Id:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MORF4L1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MORF4L1.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...