Search Antibody, Protein, and ELISA Kit Solutions

MOG Antibody - middle region (ARP83852_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
myelin oligodendrocyte glycoprotein
NCBI Gene Id:
Protein Name:
myelin-oligodendrocyte glycoprotein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
25 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MOG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MOG.
The immunogen is a synthetic peptide directed towards the middle region of human MOG
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MOG (ARP83852_P050) antibody is Catalog # AAP83852
Printable datasheet for anti-MOG (ARP83852_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...