Search Antibody, Protein, and ELISA Kit Solutions

MOB4 Antibody - N-terminal region : FITC (ARP68578_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP68578_P050 Unconjugated

ARP68578_P050-HRP Conjugated

ARP68578_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MOB4
Official Gene Full Name:
MOB family member 4, phocein
NCBI Gene Id:
25843
Protein Name:
MOB-like protein phocein
Swissprot Id:
Q9Y3A3-2
Protein Accession #:
NP_955776
Alias Symbols:
2C4D, MOB1, MOB3, PHOCN, PREI3, CGI-95, MOBKL3
Description of Target:
This gene was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. Naturally occurring read-through transcription occurs between this locus and the neighboring locus HSPE1.
Protein Size (# AA):
193
Molecular Weight:
21kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MOB4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MOB4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PHOCN
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: MDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
PPP2R1A; KIAA0368; UBR4; SPTBN1; CTTNBP2NL; STRN3; SLMAP; STRN; STK4; STK3; STK25; STK24; STK26; PAXIP1; BARD1; LATS2; LATS1; UBC; Dynll1; STRN4; FGFR1OP2; CCT3; PPP2CB; PPP2CA; STRIP1; CTTNBP2; SIKE1; STRIP2; EGFR; RAPGEF2; ZRANB1; LRIF1; MYL6; KIDINS220
Blocking Peptide:
For anti-MOB4 (ARP68578_P050-FITC) antibody is Catalog # AAP68578
Datasheets/Manuals:
Printable datasheet for anti-MOB4 (ARP68578_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...