Search Antibody, Protein, and ELISA Kit Solutions

MOAP1 Antibody - C-terminal region : FITC (ARP57614_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57614_P050 Unconjugated

ARP57614_P050-HRP Conjugated

ARP57614_P050-Biotin Conjugated

Gene Symbol:
MOAP1
NCBI Gene Id:
64112
Swissprot Id:
Q96BY2
Protein Accession #:
NP_071434
Alias Symbols:
MOAP1, PNMA4,
Replacement Item:
This antibody may replace item sc-112238 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene was identified by its interaction with apoptosis regulator BAX protein. This protein contains a Bcl-2 homology 3 (BH3)-like motif, which is required for the association with BAX. When overexpressed, this gene has been shown to mediate caspase-dependent apoptosis.
Protein Size (# AA):
351
Molecular Weight:
38kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MOAP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MOAP1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MOAP1
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LSAYVLRLEPLLQKLVQRGAIERDAVNQARLDQVIAGAVHKTIRRELNLP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
PNMA5; MBIP; THOC1; LATS1; CAMK2D; UBQLN4; FZR1; RASSF6; UBC; CACNA1A; MOAP1; CCDC85B; DPPA2; MAGEH1; RASSF1; TNFRSF10A; BAX; BCL2L1; TNFRSF1A; BCL2; TRIM39;
Blocking Peptide:
For anti-MOAP1 (ARP57614_P050-FITC) antibody is Catalog # AAP57614
Datasheets/Manuals:
Printable datasheet for anti-MOAP1 (ARP57614_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...