MNDA Antibody - C-terminal region (ARP38152_P050)

Catalog No: ARP38152_P050

WB Suggested Anti-MNDA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MNDA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KCEKGDKLRLFCLQLRTVDRKLKLVCGSHSFIKVIKAKKNKEGPMNVN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MNDA (ARP38152_P050) antibody is Catalog # AAP38152 (Previous Catalog # AAPP10734)
• Reference: Briggs,R.C., (2006) Cancer Res. 66 (9), 4645-4651

Target Info

• Gene Symbol: MNDA
• Gene Full Name: Myeloid cell nuclear differentiation antigen
• Alias Symbols: PYHIN3
• NCBI Gene Id: 4332
• Protein Name: Myeloid cell nuclear differentiation antigen
• Description of Target: The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage.MNDA may act as a transcriptional activator/repressor in the myeloid lineage. It plays a role in the granulocyte/monocyte cell-specific response to interferon. MNDA stimulates the DNA binding of the transcriptional repressor protein YY1.The myeloid cell nuclear differentiation antigen (MNDA) is detected only in nuclei of cells of the granulocyte-monocyte lineage. A 200-amino acid region of human MNDA is strikingly similar to a region in the proteins encoded by a family of interferon-inducible mouse genes, designated Ifi-201, Ifi-202, and Ifi-203, that are not regulated in a cell- or tissue-specific fashion. The 1.8-kb MNDA mRNA, which contains an interferon-stimulated response element in the 5-prime untranslated region, was significantly upregulated in human monocytes exposed to interferon alpha. MNDA is located within 2,200 kb of FCER1A, APCS, CRP, and SPTA1. In its pattern of expression and/or regulation, MNDA resembles IFI16, suggesting that these genes participate in blood cell-specific responses to interferons. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P41218
• Protein Accession #: NP_002423
• Nucleotide Accession #: NM_002432
• Protein Size (# AA): 407
• Molecular Weight: 46kDa
• Protein Interactions: PRMT6; WHSC1L1; PRMT7; TP53; RBL2; RB1; HOXB2; CDK2; CDK1;