SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP33090_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP33090_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-MMP9 (ARP33090_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MMP9
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTR
Concentration0.5 mg/ml
Blocking PeptideFor anti-MMP9 (ARP33090_T100-FITC) antibody is Catalog # AAP33090 (Previous Catalog # AAPY00103)
ReferenceNozell,S., et al., (2004) J. Biol. Chem. 279 (37), 38577-38589
Publications

Gotschy, A. et al. Local arterial stiffening assessed by MRI precedes atherosclerotic plaque formation. Circ. Cardiovasc. Imaging 6, 916-23 (2013). WB, Bovine, Horse, Human, Sheep, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Zebrafish 24100044

Li, L. et al. DLK1 promotes lung cancer cell invasion through upregulation of MMP9 expression depending on Notch signaling. PLoS One 9, e91509 (2014). WB, Bovine, Horse, Human, Sheep, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Zebrafish 24621612

Zhang, J., Jiang, W. & Zuo, Z. Pyrrolidine dithiocarbamate attenuates surgery-induced neuroinflammation and cognitive dysfunction possibly via inhibition of nuclear factor κB. Neuroscience 261, 1-10 (2014). WB, Bovine, Horse, Human, Sheep, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Zebrafish 24365462

Deng, J., Zhang, J., Feng, C., Xiong, L. & Zuo, Z. Critical role of matrix metalloprotease-9 in chronic high fat diet-induced cerebral vascular remodelling and increase of ischaemic brain injury in mice†. Cardiovasc. Res. 103, 473-84 (2014). WB, Bovine, Horse, Human, Sheep, Rat, Dog, Pig, Rabbit, Guinea pig, Mouse, Zebrafish 24935427

Gene SymbolMMP9
Gene Full NameMatrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Alias SymbolsGELB, CLG4B, MMP-9, MANDP2
NCBI Gene Id4318
Protein NameMatrix metalloproteinase-9
Description of TargetProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by MMP9 degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Uniprot IDP14780
Protein Accession #NP_004985
Nucleotide Accession #NM_004994
Protein Size (# AA)707
Molecular Weight78kDa
Protein InteractionsCXCL5; PZP; MMP26; RECK; KISS1; PRSS2; EPHB2; BTC; LCN2; COL4A6; COL4A5; TIMP3; THBS2; THBS1; MMP10; MMP7; PLG; CXCL1; TFPI; CXCL8; FN1; MMP9; COL1A2; COL1A1; COL4A4; COL4A1; COL4A2; COL4A3; HAPLN1; CD44; AREG; TGFB1; CXCL6;
  1. What is the species homology for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    This target may also be called "GELB, CLG4B, MMP-9, MANDP2" in publications.

  5. What is the shipping cost for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MMP9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MMP9"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MMP9"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MMP9"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MMP9"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MMP9"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MMP9 Antibody - N-terminal region : FITC (ARP33090_T100-FITC)
Your Rating
We found other products you might like!