MMP7 Antibody - C-terminal region : HRP (ARP74644_P050-HRP)

Catalog No: ARP74644_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MMP7
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: THELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MMP7 (ARP74644_P050-HRP) antibody is Catalog # AAP74644

Target Info

• Gene Symbol: MMP7
• Alias Symbols: MMP-7, MPSL1, PUMP-1
• NCBI Gene Id: 4316
• Description of Target: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
• Uniprot ID: P09237
• Protein Accession #: NP_002414
• Protein Size (# AA): 267
• Molecular Weight: 29kDa
• Protein Interactions: NGF; TNFSF11; CD151; BCAN; SERPINA1; PLG; SPP1; MBP; TFPI; FASLG; HBEGF; DCN; MMP9; MMP1; HAPLN1; CD44; ZBTB33;