Search Antibody, Protein, and ELISA Kit Solutions

MMP7 Antibody - C-terminal region (ARP74644_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74644_P050-FITC Conjugated

ARP74644_P050-HRP Conjugated

ARP74644_P050-Biotin Conjugated

Gene Symbol:
MMP7
NCBI Gene Id:
4316
Swissprot Id:
P09237
Protein Accession #:
NP_002414
Alias Symbols:
MMP7, MPSL1, PUMP1,
Replacement Item:
This antibody may replace item sc-101566 from Santa Cruz Biotechnology.
Description of Target:
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Protein Size (# AA):
267
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP7.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MMP7
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: THELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
NGF; TNFSF11; CD151; BCAN; SERPINA1; PLG; SPP1; MBP; TFPI; FASLG; HBEGF; DCN; MMP9; MMP1; HAPLN1; CD44; ZBTB33;
Blocking Peptide:
For anti-MMP7 (ARP74644_P050) antibody is Catalog # AAP74644
Datasheets/Manuals:
Printable datasheet for anti-MMP7 (ARP74644_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...