Search Antibody, Protein, and ELISA Kit Solutions

MMP26 Antibody - C-terminal region (ARP57558_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57558_P050-FITC Conjugated

ARP57558_P050-HRP Conjugated

ARP57558_P050-Biotin Conjugated

Gene Symbol:
MMP26
Official Gene Full Name:
Matrix metallopeptidase 26
NCBI Gene Id:
56547
Protein Name:
Matrix metalloproteinase-26
Swissprot Id:
Q9NRE1
Protein Accession #:
NP_068573
Nucleotide Accession #:
NM_021801
Alias Symbols:
MGC126590, MGC126592
Replacement Item:
This antibody may replace item sc-100558 from Santa Cruz Biotechnology.
Description of Target:
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain.
Protein Size (# AA):
261
Molecular Weight:
19kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP26.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP26.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MMP26
Predicted Species Reactivity:
Human, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 83%
Complete computational species homology data:
Anti-MMP26 (ARP57558_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SERPINA1; IGFBP1; MMP9;
Blocking Peptide:
For anti-MMP26 (ARP57558_P050) antibody is Catalog # AAP57558 (Previous Catalog # AAPP44656)
Datasheets/Manuals:
Printable datasheet for anti-MMP26 (ARP57558_P050) antibody
Sample Type Confirmation:

MMP26 is supported by BioGPS gene expression data to be expressed in A549

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...