Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP57558_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57558_P050-FITC Conjugated

ARP57558_P050-HRP Conjugated

ARP57558_P050-Biotin Conjugated

MMP26 Antibody - C-terminal region (ARP57558_P050)

Catalog#: ARP57558_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-100558 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MMP26
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rat: 83%
Complete computational species homology dataAnti-MMP26 (ARP57558_P050)
Peptide SequenceSynthetic peptide located within the following region: NLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQH
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MMP26 (ARP57558_P050) antibody is Catalog # AAP57558 (Previous Catalog # AAPP44656)
Datasheets/ManualsPrintable datasheet for anti-MMP26 (ARP57558_P050) antibody
Sample Type Confirmation

MMP26 is supported by BioGPS gene expression data to be expressed in A549

Gene SymbolMMP26
Official Gene Full NameMatrix metallopeptidase 26
Alias SymbolsMGC126590, MGC126592
NCBI Gene Id56547
Protein NameMatrix metalloproteinase-26
Description of TargetProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein degrades type IV collagen, fibronectin, fibrinogen, casein, vitronectin, alpha 1-antitrypsin, alpha 2-macroglobulin, and insulin-like growth factor-binding protein 1, and activates MMP9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain.
Swissprot IdQ9NRE1
Protein Accession #NP_068573
Nucleotide Accession #NM_021801
Protein Size (# AA)261
Molecular Weight19kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MMP26.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MMP26.
Protein InteractionsSERPINA1; IGFBP1; MMP9;
Write Your Own Review
You're reviewing:MMP26 Antibody - C-terminal region (ARP57558_P050)
Your Rating
Aviva Pathways
Free Microscope
Aviva Validation Data
Aviva Live Chat