Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
AVARP20016_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP20016_T100-FITC Conjugated

AVARP20016_T100-HRP Conjugated

AVARP20016_T100-Biotin Conjugated

MMP2 Antibody - C-terminal region (AVARP20016_T100)

Rating:
80% of 100
Catalog#: AVARP20016_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10736, HPA001939
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MMP2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-MMP2 (AVARP20016_T100)
Peptide Sequence Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MMP2 (AVARP20016_T100) antibody is Catalog # AAP30579 (Previous Catalog # AAPP01231)
Datasheets/Manuals Printable datasheet for anti-MMP2 (AVARP20016_T100) antibody
Target Reference Collier, I.E., et al., (1988) J. Biol. Chem. 263:6579-6587.
Publications

Puttabyatappa, M; Irwin, A; Martin, JD; Mesquitta, M; Veiga-Lopez, A; Padmanabhan, V; Developmental Programming: Gestational Exposure to Excess Testosterone Alters Expression of Ovarian Matrix Metalloproteases and Their Target Proteins. 1933719117697127 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28299992

Gene Symbol MMP2
Official Gene Full Name Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
Alias Symbols CLG4, MONA, CLG4A, TBE-1, MMP-II
NCBI Gene Id 4313
Protein Name 72 kDa type IV collagenase
Description of Target MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
Swissprot Id P08253
Protein Accession # NP_004521
Nucleotide Accession # NM_004530
Protein Size (# AA) 660
Molecular Weight 74kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MMP2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MMP2.
Protein Interactions HSP90AA1; CAND1; ITGB1; ITGAV; USP12; OSBPL10; SPOCK1; BACE1; PZP; MMP25; CLDN1; KISS1; MMP17; TIMP4; EPHB2; CXCL12; MMP14; BCAN; LCN2; TIMP1; TGFB1; TIMP3; TIMP2; THBS2; THBS1; CCL7; ACAN; LGALS3; IL1B; IGFBP3; FGFR1; DCN; COL18A1; COL6A3; COL1A1; COL7A1
  1. What is the species homology for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MMP2 Antibody - C-terminal region (AVARP20016_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    This target may also be called "CLG4, MONA, CLG4A, TBE-1, MMP-II" in publications.

  5. What is the shipping cost for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "74kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MMP2 Antibody - C-terminal region (AVARP20016_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MMP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MMP2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MMP2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MMP2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MMP2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MMP2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MMP2 Antibody - C-terminal region (AVARP20016_T100)
Your Rating
We found other products you might like!