Search Antibody, Protein, and ELISA Kit Solutions

MMP12 Antibody - middle region (ARP89382_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
The immunogen is a synthetic peptide directed towards the middle region of mouse MMP12
Peptide Sequence:
Synthetic peptide located within the following region: STFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSI
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MMP12 (ARP89382_P050) antibody is Catalog # AAP89382
Printable datasheet for anti-MMP12 (ARP89382_P050) antibody
Gene Symbol:
Official Gene Full Name:
matrix metallopeptidase 12
Alias Symbols:
MME, Mmel, AV378681
NCBI Gene Id:
Protein Name:
macrophage metalloelastase
Description of Target:
This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme. Mice lacking the encoded protein have a diminished capacity to degrade extracellular matrix components, do not develop emphysema in response to long-term exposure to cigarette smoke, and exhibit impaired clearance and increased mortality upon bacterial infection. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. Alternate splicing generates multiple transcript variants encoding distinct isoforms.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
52 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MMP12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MMP12.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...