Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OAAF07844 (Formerly GWB-ASB996)
Size:100 ug
Price: $344.00
SKU
OAAF07844
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot
Additional InformationModification Sites: Human:S296/318 Mouse:S296/322 Rat:S296/319
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human MKP-1/2 around the phosphorylation site of Ser296/318.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: GISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFES
Concentration1mg/ml
SpecificityMKP-1/2 (Phospho-Ser296/318) Antibody detects endogenous levels of MKP-1/2 only when phosphorylated at Ser296/318.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application InfoWB: 1:500~1:1000
IHC: 1:50~1:100
ELISA: 1:5000
Gene SymbolDUSP1|DUSP4
Gene Full Namedual specificity phosphatase 1|dual specificity phosphatase 4
Alias SymbolsCL 100;CL100;dual specificity protein phosphatase 1;dual specificity protein phosphatase 4;dual specificity protein phosphatase hVH1;dual specificity protein phosphatase hVH2;HVH1;HVH2;MAP kinase phosphatase 1;MAP kinase phosphatase 2;mitogen-activated protein kinase phosphatase 1;mitogen-activated protein kinase phosphatase 2;MKP1;MKP-1;MKP2;MKP-2;protein-tyrosine phosphatase CL100;PTPN10;serine/threonine specific protein phosphatase;TYP;VH1 homologous phosphatase 2.
NCBI Gene Id1843|1846
Protein NameDual specificity protein phosphatase 1|Dual specificity protein phosphatase 4
Description of TargetDual specificity phosphatase that dephosphorylates MAP kinase MAPK1/ERK2 on both 'Thr-183' and 'Tyr-185', regulating its activity during the meiotic cell cycle.|Regulates mitogenic signal transduction by dephosphorylating both Thr and Tyr residues on MAP kinases ERK1 and ERK2.
Uniprot IDP28562|Q13115
Molecular Weight39 kDa
  1. What is the species homology for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    This target may also be called "CL 100;CL100;dual specificity protein phosphatase 1;dual specificity protein phosphatase 4;dual specificity protein phosphatase hVH1;dual specificity protein phosphatase hVH2;HVH1;HVH2;MAP kinase phosphatase 1;MAP kinase phosphatase 2;mitogen-activated protein kinase phosphatase 1;mitogen-activated protein kinase phosphatase 2;MKP1;MKP-1;MKP2;MKP-2;protein-tyrosine phosphatase CL100;PTPN10;serine/threonine specific protein phosphatase;TYP;VH1 homologous phosphatase 2." in publications.

  5. What is the shipping cost for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DUSP1|DUSP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DUSP1|DUSP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DUSP1|DUSP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DUSP1|DUSP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DUSP1|DUSP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DUSP1|DUSP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MKP-1/2 Antibody (Phospho-Ser296/318) (OAAF07844)
Your Rating
We found other products you might like!