Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MIXL1 antibody - N-terminal region : HRP (ARP30077_P050-HRP)

100 ul
$289.00
In Stock

Conjugation Options

ARP30077_P050 Unconjugated

ARP30077_P050-FITC Conjugated

ARP30077_P050-Biotin Conjugated

Gene Symbol:
MIXL1
NCBI Gene Id:
83881
Official Gene Full Name:
Mix paired-like homeobox
Protein Name:
Homeobox protein MIXL1
Swissprot Id:
Q9H2W2
Protein Accession #:
NP_114150
Nucleotide Accession #:
NM_031944
Alias Symbols:
MIX, MIXL, MILD1
Replacement Item:
This antibody may replace item sc-104376 from Santa Cruz Biotechnology.
Description of Target:
MIXL1 is a novel human Mix-like homeobox gene. In normal hematopoiesis, its expression appears to be restricted to immature B- and T-lymphoid cells.
Protein Size (# AA):
232
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIXL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIXL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MIXL1
Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MIXL1 (ARP30077_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Blocking Peptide:
For anti-MIXL1 (ARP30077_P050-HRP) antibody is Catalog # AAP30077 (Previous Catalog # AAPH00253)
Datasheets/Manuals:
Printable datasheet for anti-MIXL1 (ARP30077_P050-HRP) antibody
Conjugation:
HRP
Target Reference:
Hart,A.H., et al., (2005) Biochem. Biophys. Res. Commun. 333 (4), 1361-1369

Tell us what you think about this item!

Write A Review
    Please, wait...