Search Antibody, Protein, and ELISA Kit Solutions

MIXL1 Antibody - N-terminal region (ARP30077_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30077_P050-FITC Conjugated

ARP30077_P050-HRP Conjugated

ARP30077_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Mix paired-like homeobox
NCBI Gene Id:
Protein Name:
Homeobox protein MIXL1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-104376 from Santa Cruz Biotechnology.
Description of Target:
MIXL1 is a novel human Mix-like homeobox gene. In normal hematopoiesis, its expression appears to be restricted to immature B- and T-lymphoid cells.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIXL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIXL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human MIXL1
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MIXL1 (ARP30077_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MIXL1 (ARP30077_P050) antibody is Catalog # AAP30077 (Previous Catalog # AAPH00253)
Printable datasheet for anti-MIXL1 (ARP30077_P050) antibody
Target Reference:
Hart,A.H., et al., (2005) Biochem. Biophys. Res. Commun. 333 (4), 1361-1369

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...