$0.00
In Stock
SKU
OPCA26768
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MINOS1-NBL1 Recombinant Protein (Human) (OPCA26768)

Catalog#: OPCA26768
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Predicted Species Reactivity Human
Product Format Liquid
Host E. coli, yeast, insect, or mammalian cell can be selected above to determine price.
Application WB, ELISA
Additional Information For Research Use Only.
Sterile filtering available upon request.
Low endotoxin available upon request.
Reconstitution and Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity Greater than 85% as determined by SDS-PAGE.
Protein Sequence AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Storage Buffer Tris-based buffer,50% glycerol
Tag This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.
Datasheets/Manuals Printable datasheet for OPCA26768
Gene Symbol MINOS1-NBL1
Official Gene Full Name MINOS1-NBL1 readthrough
Alias Symbols C1orf151-NBL1
NCBI Gene Id 100532736; 4681;
Protein Name C1orf151-NBL1 read-through protein
Description of Target This locus represents naturally occurring read-through transcription between the neighboring chromosome 1 open reading frame 151 (GeneID 440574) and neuroblastoma suppressor of tumorigenicity 1 (GeneID 4681) genes on chromosome 1. The read-through transcripts produce at least two proteins, each of which share identity with proteins translated from the downstream neuroblastoma suppressor of tumorigenicity 1 locus.
Swissprot Id P41271
Protein Accession # NP_001191013.1
Nucleotide Accession # NM_001204084.2
Protein Size (# AA) 165
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MINOS1-NBL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MINOS1-NBL1.
Write Your Own Review
You're reviewing:MINOS1-NBL1 Recombinant Protein (Human) (OPCA26768)
Your Rating