MIG Protein (OPPA00430)

Catalog No: OPPA00430 (Formerly GWB-6F4C09)

Size:5UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Lyophilized from a 0.2um filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized MIG in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
  Biological Activity: Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10.0-100.0 ng/ml.
  Product Introduction: Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma interferon (MIG). CXCL9 is a T-cell chemoattractant, which is induced by IFN-*. It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.
  Product Description: MIG (monokine induced by gamma-interferon) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques.
• Reconstitution and Storage: Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CXCL9 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
• Purity: Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT.

Target Info

• Gene Symbol: MIG
• Alias Symbols: CMK, MIG, Humig, SCYB9, crg-10
• NCBI Gene Id: 4283
• Protein Name: C-X-C motif chemokine 9
• Description of Target: Recombinant Human MIG (CXCL9)
• Uniprot ID: Q07325
• Protein Accession #: NP_002407.1
• Protein Size (# AA): Recombinant