Size:100 ul
$229.00
In Stock
SKU
ARP40950_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40950_T100-FITC Conjugated

ARP40950_T100-HRP Conjugated

ARP40950_T100-Biotin Conjugated

MIF4GD Antibody - C-terminal region (ARP40950_T100)

Catalog#: ARP40950_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-102025 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MIF4GD
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-MIF4GD (ARP40950_T100)
Peptide SequenceSynthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MIF4GD (ARP40950_T100) antibody is Catalog # AAP40950 (Previous Catalog # AAPS02701)
Datasheets/ManualsPrintable datasheet for anti-MIF4GD (ARP40950_T100) antibody
Target ReferenceStrausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications

Okada, K. et al. Expression analysis of MIF4GD in the rat testis. J. Reprod. Dev. 57, 256-61 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21157122

Gene SymbolMIF4GD
Official Gene Full NameMIF4G domain containing
Alias SymbolsMIFD, AD023, SLIP1
NCBI Gene Id57409
Protein NameMIF4G domain-containing protein
Description of TargetMIF4GD is a protein which contains an MIF4G domain.This gene encodes a protein which contains an MIF4G domain.
Swissprot IdQ8N4Q5
Protein Accession #NP_065730
Nucleotide Accession #NM_020679
Protein Size (# AA)256
Molecular Weight28kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MIF4GD.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MIF4GD.
Protein InteractionsDDX19A; DDX19B; PDE4DIP; HGS; EXOSC6; HDAC4; PPARG; LSM5; PDXDC1; PPIP5K1; DHX16; ILF2; HINFP; UBQLN4; SVIL;
  1. What is the species homology for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MIF4GD Antibody - C-terminal region (ARP40950_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    This target may also be called "MIFD, AD023, SLIP1" in publications.

  5. What is the shipping cost for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MIF4GD Antibody - C-terminal region (ARP40950_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MIF4GD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MIF4GD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MIF4GD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MIF4GD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MIF4GD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MIF4GD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MIF4GD Antibody - C-terminal region (ARP40950_T100)
Your Rating
Aviva Tips and Tricks
Aviva Pathways
Aviva HIS tag Deal
Aviva Blast Tool