Search Antibody, Protein, and ELISA Kit Solutions

MIF4GD Antibody - C-terminal region (ARP40950_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40950_T100-FITC Conjugated

ARP40950_T100-HRP Conjugated

ARP40950_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-102025 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the C terminal region of human MIF4GD
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MIF4GD (ARP40950_T100)
Peptide Sequence:
Synthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MIF4GD (ARP40950_T100) antibody is Catalog # AAP40950 (Previous Catalog # AAPS02701)
Printable datasheet for anti-MIF4GD (ARP40950_T100) antibody
Target Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Okada, K. et al. Expression analysis of MIF4GD in the rat testis. J. Reprod. Dev. 57, 256-61 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21157122

Gene Symbol:
Official Gene Full Name:
MIF4G domain containing
Alias Symbols:
NCBI Gene Id:
Protein Name:
MIF4G domain-containing protein
Description of Target:
MIF4GD is a protein which contains an MIF4G domain.This gene encodes a protein which contains an MIF4G domain.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIF4GD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIF4GD.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...