Search Antibody, Protein, and ELISA Kit Solutions

MIF4GD Antibody - C-terminal region (ARP40950_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40950_T100-FITC Conjugated

ARP40950_T100-HRP Conjugated

ARP40950_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MIF4GD
Official Gene Full Name:
MIF4G domain containing
NCBI Gene Id:
57409
Protein Name:
MIF4G domain-containing protein
Swissprot Id:
Q8N4Q5
Protein Accession #:
NP_065730
Nucleotide Accession #:
NM_020679
Alias Symbols:
MIFD, AD023, SLIP1
Replacement Item:
This antibody may replace item sc-102025 from Santa Cruz Biotechnology.
Description of Target:
MIF4GD is a protein which contains an MIF4G domain.This gene encodes a protein which contains an MIF4G domain.
Protein Size (# AA):
256
Molecular Weight:
28kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIF4GD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIF4GD.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MIF4GD
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MIF4GD (ARP40950_T100)
Peptide Sequence:
Synthetic peptide located within the following region: LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DDX19A; DDX19B; PDE4DIP; HGS; EXOSC6; HDAC4; PPARG; LSM5; PDXDC1; PPIP5K1; DHX16; ILF2; HINFP; UBQLN4; SVIL;
Blocking Peptide:
For anti-MIF4GD (ARP40950_T100) antibody is Catalog # AAP40950 (Previous Catalog # AAPS02701)
Datasheets/Manuals:
Printable datasheet for anti-MIF4GD (ARP40950_T100) antibody
Target Reference:
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
Publications:

Okada, K. et al. Expression analysis of MIF4GD in the rat testis. J. Reprod. Dev. 57, 256-61 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21157122

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...