MIF Protein His N (OPPA00690)

Datasheets/Manuals	Printable datasheet for OPPA00690

Product Info
Predicted Species Reactivity	Human
Product Format	1mg/ml solution containing PBS pH-7.4.
Host	E. Coli
::	Product Introduction: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration. Product Description: MIF human Recombinant, fused to His-tag at N-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain having amino acids from 1-114 and having a molecular mass of 16.6 kDa.
Reconstitution and Storage	Liquid MIF although stable 4C for 1 week, should be stored desiccated below -18C. Please prevent freeze-thaw cycles.
Purity	Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Peptide Sequence	MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.

Gene Symbol	MIF His N
Alias Symbols	GIF, GLIF, MMIF
NCBI Gene Id	4282
Protein Name	Macrophage migration inhibitory factor
Description of Target	Recombinant Human Macrophage Migration Inhibitor Factor, His Tag N-Terminus
Uniprot ID	P14174
Protein Accession #	NP_002406.1
Protein Size (# AA)	Recombinant

Protocol:

Tips Information:

See our General FAQ page.

Protein interactions

Biological pathways

Name	# of Products
Cell proliferation	731
Cell surface receptor linked signaling pathway	420
Inflammatory response	911
Innate immune response	905
Negative regulation of apoptotic process	538
Negative regulation of cell aging	20
Negative regulation of cell cycle arrest	30
Negative regulation of DNA damage response, signal transduction by p53 class mediator	37
Negative regulation of gene expression	17
Positive regulation of B cell proliferation	254
Positive regulation of cytokine secretion	124
Positive regulation of ERK1 and ERK2 cascade	194
Positive regulation of fibroblast proliferation	119
Positive regulation of peptidyl-serine phosphorylation	168
Positive regulation of peptidyl-tyrosine phosphorylation	308
Positive regulation of protein kinase A signaling cascade	29
Prostaglandin biosynthetic process	41
Protein homotrimerization	27
Regulation of macrophage activation	15

Biological process

Name	# of Products
Carboxylic acid metabolic process	8
Cell proliferation	293
Cell surface receptor signaling pathway	179
Inflammatory response	339
Innate immune response	300
Negative regulation of apoptotic process	356
Negative regulation of cell aging	8
Negative regulation of cell cycle arrest	14
Negative regulation of DNA damage response, signal transduction by p53 class mediator	17
Negative regulation of gene expression	70
Positive chemotaxis	33
Positive regulation of B cell proliferation	66
Positive regulation of cytokine secretion	38
Positive regulation of ERK1 and ERK2 cascade	103
Positive regulation of fibroblast proliferation	47
Positive regulation of peptidyl-serine phosphorylation	63
Positive regulation of peptidyl-tyrosine phosphorylation	112
Positive regulation of phosphorylation	34
Positive regulation of protein kinase A signaling cascade	6
Prostaglandin biosynthetic process	19
Protein homotrimerization	19
Regulation of macrophage activation	7

Cellular components

Protein function

Name	# of Products
Cell surface binding	163
Chemoattractant activity	120
Cytokine activity	1104
Cytokine receptor binding	78
Dopachrome isomerase activity	14
Isomerase activity	236
Phenylpyruvate tautomerase activity	9
Protein binding	12191
Receptor binding	932