MIF Protein His C (OPPA01502)

Catalog No: OPPA01502 (Formerly GWB-B0699F)

Size:5UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Human MIF was lyophilized from a 1mg/ml solution containing PBS pH-7.4. Physical appearance: Sterile Filtered lyophilized powder.
• Host: E. Coli
• Additional Information: Solubility: It is recommended to reconstitute the lyophilized MIF in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
  Biological Activity: Measured by its ability to bind rhCD74 in a functional ELISA.
  Product Introduction: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
  Product Description: MIF human Recombinant, fused to His-tag at C-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chaincontaining 123 amino acidsand having a molecular mass of 13.5 kDa.
• Reconstitution and Storage: Lyophilized MIF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MIF should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles.
• Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
• Peptide Sequence: MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFALEHHHHHH.

Target Info

• Gene Symbol: MIF His C
• Alias Symbols: GIF, GLIF, MMIF
• NCBI Gene Id: 4282
• Protein Name: Macrophage migration inhibitory factor
• Description of Target: Recombinant Human Macrophage Migration Inhibitor Factor, His Tag C-Terminus
• Uniprot ID: P14174
• Protein Accession #: NP_002406.1
• Protein Size (# AA): Recombinant