Search Antibody, Protein, and ELISA Kit Solutions

MICALL1 Antibody - N-terminal region (ARP51692_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP51692_P050-FITC Conjugated

ARP51692_P050-HRP Conjugated

ARP51692_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
MICAL-like 1
NCBI Gene Id:
Protein Name:
MICAL-like protein 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp686M2226, FLJ45921, KIAA1668, MICAL-L1, MIRAB13
Replacement Item:
This antibody may replace item sc-133787 from Santa Cruz Biotechnology.
Description of Target:
MICALL1 contains 1 CH (calponin-homology) domain and 1 LIM zinc-binding domain. It may be a cytoskeletal regulator.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MICALL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MICALL1.
The immunogen is a synthetic peptide directed towards the N terminal region of human MICALL1
Predicted Species Reactivity:
Goat, Human
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Goat: 82%; Human: 100%
Complete computational species homology data:
Anti-MICALL1 (ARP51692_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MICALL1 (ARP51692_P050) antibody is Catalog # AAP51692 (Previous Catalog # AAPY02524)
Printable datasheet for anti-MICALL1 (ARP51692_P050) antibody
Sample Type Confirmation:

MICALL1 is supported by BioGPS gene expression data to be expressed in HEK293T, HepG2

Target Reference:
Jin,J., (2004) Curr. Biol. 14 (16), 1436-1450

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...