Catalog No: OPPA01280 (Formerly GWB-F774F4)
Size:2UG
Price: $75.00
SKU
OPPA01280
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPPA01280 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized from a concentrated (1mg/ml) solution containing no additives. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder. |
Host | E. Coli |
Additional Information | Solubility: It is recommended to reconstitute the lyophilized MICA in sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. |
:: | Biological Activity: Measured by its ability to bind MICA antibody in a ELISA. |
:: | Product Introduction: MICA (MHC class I chain-related gene A) is a transmembrane glycoprotein that functions as a ligand for human NKG2D. A closely related protein, MICB, shares 85% amino acid identity with MICA. These proteins are distantly related to the MHC class I proteins. They possess three extracellular Ig-like domains, but they have no capacity to bind peptide or interact with *2-microglobulin. The genes encoding these proteins are found within the Major Histocompatibility Complex on human chromosome 6. The MICA locus is highly polymorphic with more than 50 recognized human alleles. MICA is absent from most cells but is frequently expressed in epithelial tumors and can be induced by bacterial and viral infections. MICA is a ligand for human NKG2D, an activating receptor expressed on NK cells, NKT cells, * * T cells, and CD8+ * * T cells. Recognition of MICA by NKG2D results in the activation of cytolytic activity and/or cytokine production by these effector cells. MICA recognition is involved in tumor surveillance, viral infections, and autoimmune diseases. Product Description: MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 - Gln308) The MICA is purified by proprietary chromatographic techniques. |
Reconstitution and Storage | Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution MICA should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA). Please prevent freeze-thaw cycles. |
Purity | Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. |
Peptide Sequence | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH. |
Gene Symbol | MICA |
---|---|
Alias Symbols | PERB11.1 |
NCBI Gene Id | 4276 |
Protein Name | MHC class I polypeptide-related sequence A |
Description of Target | Recombinant Human MHC class I chain-related gene A |
Uniprot ID | Q29983 |
Protein Accession # | NP_000238.1 |
Protein Size (# AA) | Recombinant |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!