Size:100 ul
$289.00
In Stock
SKU
ARP70076_P050-FITC
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP70076_P050 Unconjugated

ARP70076_P050-HRP Conjugated

ARP70076_P050-Biotin Conjugated

MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)

Catalog#: ARP70076_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityCow, Dog, Horse, Human, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC (FAM): Excitation 495 nm/ Emission 520 nm
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-133488 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 92%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%
Peptide SequenceSynthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MIA2 (ARP70076_P050-FITC) antibody is Catalog # AAP70076
Datasheets/ManualsPrintable datasheet for anti-MIA2 (ARP70076_P050-FITC) antibody
Gene SymbolMIA2
Official Gene Full NameMIA SH3 domain ER export factor 2
Alias SymbolsMEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11
NCBI Gene Id4253
Protein NamecTAGE family member 5; melanoma inhibitory activity protein 2
Description of TargetThis gene encodes s receptor in the endoplasmic reticulum, which plays a role in the export of large pre-chylomicrons and pre-very low density lipoproteins (pre-VLDLs). Three major classes of transcripts are generated from this gene- melanoma inhibitory activity 2-specific transcripts, cTAGE family member 5-specific transcripts and transcripts that include exons from both these transcript species (TANGO1-like or TALI). Additionally, alternative splicing in these transcripts results in multiple transcript variants encoding multiple isoforms.
Swissprot IdO15320-9
Protein Size (# AA)672
Molecular Weight73kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MIA2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MIA2.
Protein InteractionsRASAL2; PSMA3; AES; MAGEB18; TTC23L; CCHCR1; SS18L1; EMILIN1; CEP57; DGCR6; Dlg4; UBC; GRB2; ALB;
Write Your Own Review
You're reviewing:MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)
Your Rating
Aviva Travel Grant
Aviva Tissue Tool
Aviva Live Chat
Aviva HIS tag Deal