Search Antibody, Protein, and ELISA Kit Solutions

MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP70076_P050 Unconjugated

ARP70076_P050-HRP Conjugated

ARP70076_P050-Biotin Conjugated

Gene Symbol:
MIA2
Official Gene Full Name:
MIA SH3 domain ER export factor 2
NCBI Gene Id:
4253
Protein Name:
cTAGE family member 5; melanoma inhibitory activity protein 2
Swissprot Id:
O15320-9
Alias Symbols:
MEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11
Replacement Item:
This antibody may replace item sc-133488 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes s receptor in the endoplasmic reticulum, which plays a role in the export of large pre-chylomicrons and pre-very low density lipoproteins (pre-VLDLs). Three major classes of transcripts are generated from this gene- melanoma inhibitory activity 2-specific transcripts, cTAGE family member 5-specific transcripts and transcripts that include exons from both these transcript species (TANGO1-like or TALI). Additionally, alternative splicing in these transcripts results in multiple transcript variants encoding multiple isoforms.
Protein Size (# AA):
672
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Pig, Rabbit
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 92%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%
Peptide Sequence:
Synthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
RASAL2; PSMA3; AES; MAGEB18; TTC23L; CCHCR1; SS18L1; EMILIN1; CEP57; DGCR6; Dlg4; UBC; GRB2; ALB;
Blocking Peptide:
For anti-MIA2 (ARP70076_P050-FITC) antibody is Catalog # AAP70076
Datasheets/Manuals:
Printable datasheet for anti-MIA2 (ARP70076_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...