MIA2 Antibody - middle region : FITC (ARP70076_P050-FITC)

Catalog No: ARP70076_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 92%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%
• Peptide Sequence: Synthetic peptide located within the following region: EKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MIA2 (ARP70076_P050-FITC) antibody is Catalog # AAP70076

Target Info

• Gene Symbol: MIA2
• Gene Full Name: MIA SH3 domain ER export factor 2
• Alias Symbols: MEA6, MGEA, TALI, MGEA6, CTAGE5, MGEA11
• NCBI Gene Id: 4253
• Protein Name: cTAGE family member 5; melanoma inhibitory activity protein 2
• Description of Target: This gene encodes s receptor in the endoplasmic reticulum, which plays a role in the export of large pre-chylomicrons and pre-very low density lipoproteins (pre-VLDLs). Three major classes of transcripts are generated from this gene- melanoma inhibitory activity 2-specific transcripts, cTAGE family member 5-specific transcripts and transcripts that include exons from both these transcript species (TANGO1-like or TALI). Additionally, alternative splicing in these transcripts results in multiple transcript variants encoding multiple isoforms.
• Uniprot ID: O15320-9
• Protein Size (# AA): 672
• Molecular Weight: 73kDa
• Protein Interactions: RASAL2; PSMA3; AES; MAGEB18; TTC23L; CCHCR1; SS18L1; EMILIN1; CEP57; DGCR6; Dlg4; UBC; GRB2; ALB;