Search Antibody, Protein, and ELISA Kit Solutions

MIA2 Antibody - C-terminal region (ARP60753_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60753_P050-FITC Conjugated

ARP60753_P050-HRP Conjugated

ARP60753_P050-Biotin Conjugated

Gene Symbol:
MIA2
Official Gene Full Name:
Melanoma inhibitory activity 2
NCBI Gene Id:
117153
Protein Name:
Melanoma inhibitory activity protein 2
Swissprot Id:
Q96PC5-2
Protein Accession #:
NP_473365
Nucleotide Accession #:
NM_054024
Alias Symbols:
FLJ22404
Replacement Item:
This antibody may replace item sc-160524 from Santa Cruz Biotechnology.
Description of Target:
MIA2 may play a role in the pathophysiology of liver disease and may serve as a marker of liver damage.
Protein Size (# AA):
654
Molecular Weight:
74kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MIA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MIA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MIA2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MIA2 (ARP60753_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KHDRBS1;
Blocking Peptide:
For anti-MIA2 (ARP60753_P050) antibody is Catalog # AAP60753 (Previous Catalog # AAPP46946)
Datasheets/Manuals:
Printable datasheet for anti-MIA2 (ARP60753_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...