Search Antibody, Protein, and ELISA Kit Solutions

MGC39633 Antibody - N-terminal region (ARP44931_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP44931_T100-FITC Conjugated

ARP44931_T100-HRP Conjugated

ARP44931_T100-Biotin Conjugated

Gene Symbol:
CCDC112
Official Gene Full Name:
Coiled-coil domain containing 112
NCBI Gene Id:
153733
Protein Name:
Coiled-coil domain-containing protein 112
Swissprot Id:
Q6A334
Protein Accession #:
NP_001035530
Nucleotide Accession #:
NM_001040440
Alias Symbols:
MBC1, MGC39633
Replacement Item:
This antibody may replace item sc-101913 from Santa Cruz Biotechnology.
Description of Target:
The function remains unknown.
Protein Size (# AA):
529
Molecular Weight:
62kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MGC39633.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MGC39633.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MGC39633
Predicted Species Reactivity:
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-MGC39633 (ARP44931_T100)
Peptide Sequence:
Synthetic peptide located within the following region: VRTAEKFKNQVINMEKDKHSHFYNQKSDFRIEHSMLEELENKLIHSRKTE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
KRT40; FSD2; TNIP1; KRT31; LURAP1; CCDC85B; TEX9;
Blocking Peptide:
For anti-CCDC112 (ARP44931_T100) antibody is Catalog # AAP44931 (Previous Catalog # AAPP26012)
Datasheets/Manuals:
Printable datasheet for anti-CCDC112 (ARP44931_T100) antibody
Target Reference:
Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...