Search Antibody, Protein, and ELISA Kit Solutions

MFN2 Antibody - C-terminal region (ARP42420_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP42420_P050-FITC Conjugated

ARP42420_P050-HRP Conjugated

ARP42420_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MFN2
Official Gene Full Name:
Mitofusin 2
NCBI Gene Id:
9927
Protein Name:
Mitofusin-2
Swissprot Id:
O95140
Protein Accession #:
NP_055689
Nucleotide Accession #:
NM_014874
Alias Symbols:
CMT2A, CMT2A2, CPRP1, HSG, KIAA0214, MARF
Replacement Item:
This antibody may replace item sc-100560 from Santa Cruz Biotechnology.
Description of Target:
MFN2 is a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. It is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke.This gene encodes a mitochondrial membrane protein that participates in mitochondrial fusion and contributes to the maintenance and operation of the mitochondrial network. This protein is involved in the regulation of vascular smooth muscle cell proliferation, and it may play a role in the pathophysiology of obesity. Mutations in this gene cause Charcot-Marie-Tooth disease type 2A2, and hereditary motor and sensory neuropathy VI, which are both disorders of the peripheral nervous system. Defects in this gene have also been associated with early-onset stroke. Two transcript variants encoding the same protein have been identified.
Protein Size (# AA):
757
Molecular Weight:
86kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MFN2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MFN2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MFN2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-MFN2 (ARP42420_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MARCH5; PARK2; UBE2N; MFN2; TER94; MAVS; vpr; HUWE1; MAPK9;
Blocking Peptide:
For anti-MFN2 (ARP42420_P050) antibody is Catalog # AAP42420 (Previous Catalog # AAPP11559)
Datasheets/Manuals:
Printable datasheet for anti-MFN2 (ARP42420_P050) antibody
Target Reference:
Chung,K.W., (2008) Neurology 70 (21), 2010-2011
Publications:

Hepatitis C virus NS5A protein cooperates with phosphatidylinositol 4-kinase IIIα to induce mitochondrial fragmentation. Sci Rep. 6: 23464 (2016). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 27010100

Product Reviews

Average Rating:
2 reviews
5 star
2
4 star
0
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

2 Item(s)

122/05/2019 23:01
  • Overall Experience:
  • Quality:
Mouse brain, subcellular fractions in WB

Submitted by:
Anonymous
MFN2

Sample type: Mouse brain, subcellular fractions.
Lane 1: 30ug mouse brain subcellular fraction (pure mitochondria)
Lane 2: 30ug mouse brain subcellular fraction (crude mitochondria)

Sample preparation method: ref: Wieckowski MR, Nature protocols, 2009; 4(11):1582-90.

Primary antibody dilution: 1:5000

Secondary antibody and dilution: 1:2000

0
0
Reply
Show more comments (-2) Hide comments
84/03/2018 18:23
  • Overall Experience:
  • Quality:
Mouse Embryonic Fibroblasts in WB

Submitted By:

Jeremy Chambers

Herbert Wertheim College of Medicine

1.       Target Name:

MFN2

2.       Sample type/lane description:

Mouse: HeLa, Wild type mouse embryonic fibroblast (WTMEF), c-Jun N-terminal kinase knock out mouse embryonic fibroblast (JNK-/-)

Lane 1: 25ug HeLa cells

Lane 2: 25ug WTMEF cells

Lane 3: 25ug JNK cells

Aviva’s MFN2 antibody stained green (MFN2). B-actin (red) with separate antibody.

3.       Primary antibody dilution:

1:500

4.       Secondary antibody and dilution:

LICOR Biosciences - 1:15000

5.       Protocol:

HeLa, WTMEF (wild type mouse embryonic fibrolast), and JNK (c-jun N-terminal kinase) k/o MEFs were grown to 90% confluency in p35. Cells were washed twice with ice-cold PBS and 100ul of lysis buffer (50mM Tris-HCl pH 7.8, 150mM NaCl, 1% NP-40, 0.2% Sodium deoxycholate) containing protease and phosphatase inhibitors were added to each well. The plates were incubated rocking at 4˚C for 5 minutes. Cells were scrapped with cell scrapper and were sonicated for 30 seconds. Cell lysate was left on ice for 5 minutes and centrifuged at 15,000rpm for 15 minutes. The supernatant obtained was collected in new tube and stored at -80˚C.

BCA assay was done to determine the protein concentration.  25ug of protein was mixed with 6X loading dye. The protein sample was denatured by heating at 95˚C for 5 minutes.  The sample was left on ice for 5 minutes.

The samples were loaded on the gel and ran at 100V. Protein was transferred to the nitrocellulose membrane by wet transfer. The transfer was done at 100V for 90 mins.  The membrane was washed with water and incubated with blocking buffer (0.1% TBS, 5%BSA), rocking for one hour at RT. It was incubated O/N with primary antibody (1:500) in blocking buffer (0.1% TBST, 5% BSA) at 4°C. Loading control was used in the ratio of 1:10000.

After incubation, the membrane was washed 3X with 0.1% TBST, rocking for 10 minutes at RT. It was incubated with secondary antibody (LICOR anti-rabbit) in the ratio of 1:15000 in blocking buffer (0.1% TBST, 5% BSA) for 1 hour at room temperature.  The membrane was washed as before and scanned in the Odyssey scanner.

0
0
Reply
Show more comments (-2) Hide comments

2 Item(s)

What kind of abuse are you reporting?
    Please, wait...