Search Antibody, Protein, and ELISA Kit Solutions

MFGE8 Antibody - middle region (ARP80880_P050)

100 ul
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
milk fat globule-EGF factor 8 protein
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
BA46, HMFG, MFGM, SED1, hP47, EDIL1, MFG-E8, SPAG10, OAcGD3S, HsT19888
Description of Target:
This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants.
Protein Size (# AA):
Molecular Weight:
35 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MFGE8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MFGE8.
The immunogen is a synthetic peptide directed towards the middle region of human MFGE8
Peptide Sequence:
Synthetic peptide located within the following region: KEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPG
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MFGE8 (ARP80880_P050) antibody is Catalog # AAP80880
Printable datasheet for anti-MFGE8 (ARP80880_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...