MET Protein (OPPA00194)

Catalog No: OPPA00194 (Formerly GWB-BSP533)

Size:2UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid 50mM Tris, 300mM NaCl, 10% glycerol (pH 7.5)
  Physical Appearance: Sterile filtered clear colorless solution
• Host: Insect cells.
• Reconstitution and Storage: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
• Purification: c-MET is purified by proprietary chromatographic techniques.
• Concentration: 1 mg/ml
• Purity: Greater than 90.0% as determined by SDS-PAGE.
• Peptide Sequence: DSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFG VLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEM RPSFSELVSRISAIFSTFI.

Target Info

• Gene Symbol: MET
• Alias Symbols: Hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, Proto-oncogene c-Met, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met, MET, HGFR, AUTS9, RCCP2.
• Description of Target: Mesenchymal epithelial transition factor (c-MET) is a proto-oncogenic receptor tyrosine kinase. The endogenous ligand for c-MET is HGF (hepatocyte growth factor), which is a disulfide-linked heterodimeric molecule produced predominantly by mesenchymal cells. In the adult, c-MET protein expression is limited to stem and progenitor cells and is required for wound healing and hepatocyte regeneration. In the embryo, c-MET receptors are expressed on cells of epithelial origin, which are vital for invasive growth and mediate epithelial-mesenchymal transition (EMT). Abnormal activation of the HGF/MET pathway leads to a variety of cancers. c-MET mutation is linked with a poor prognosis since it can trigger tumor growth, angiogenesis and metastasis.
  Product Description: Met Proto-Oncogene Human Recombinant produced in Insect cells amino acids 1039-1345.
• Protein Size (# AA): Recombinant
• Molecular Weight: 35 kDa