Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP35960_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP35960_P050-FITC Conjugated

ARP35960_P050-HRP Conjugated

ARP35960_P050-Biotin Conjugated

MESP1 Antibody - C-terminal region (ARP35960_P050)

Catalog#: ARP35960_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130461 from Santa Cruz Biotechnology.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 90%; Horse: 90%; Human: 100%
Complete computational species homology data Anti-MESP1 (ARP35960_P050)
Peptide Sequence Synthetic peptide located within the following region: GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MESP1 (ARP35960_P050) antibody is Catalog # AAP35960 (Previous Catalog # AAPP07218)
Datasheets/Manuals Printable datasheet for anti-MESP1 (ARP35960_P050) antibody
Gene Symbol MESP1
Official Gene Full Name Mesoderm posterior 1 homolog (mouse)
Alias Symbols MGC10676, bHLHc5
NCBI Gene Id 55897
Protein Name Mesoderm posterior protein 1
Description of Target MESP1 is a transcription factor. MESP1 plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. MESP1 defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
Swissprot Id Q9BRJ9
Protein Accession # NP_061140
Nucleotide Accession # NM_018670
Protein Size (# AA) 268
Molecular Weight 28kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MESP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MESP1.
  1. What is the species homology for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Horse, Human".

  2. How long will it take to receive "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MESP1 Antibody - C-terminal region (ARP35960_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    This target may also be called "MGC10676, bHLHc5" in publications.

  5. What is the shipping cost for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MESP1 Antibody - C-terminal region (ARP35960_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MESP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MESP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MESP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MESP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MESP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MESP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MESP1 Antibody - C-terminal region (ARP35960_P050)
Your Rating
We found other products you might like!