Search Antibody, Protein, and ELISA Kit Solutions

MESP1 Antibody - C-terminal region (ARP35960_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35960_P050-FITC Conjugated

ARP35960_P050-HRP Conjugated

ARP35960_P050-Biotin Conjugated

Gene Symbol:
MESP1
Official Gene Full Name:
Mesoderm posterior 1 homolog (mouse)
NCBI Gene Id:
55897
Protein Name:
Mesoderm posterior protein 1
Swissprot Id:
Q9BRJ9
Protein Accession #:
NP_061140
Nucleotide Accession #:
NM_018670
Alias Symbols:
MGC10676, bHLHc5
Replacement Item:
This antibody may replace item sc-130461 from Santa Cruz Biotechnology.
Description of Target:
MESP1 is a transcription factor. MESP1 plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. MESP1 defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways.
Protein Size (# AA):
268
Molecular Weight:
28kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MESP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MESP1.
Predicted Species Reactivity:
Cow, Horse, Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 90%; Horse: 90%; Human: 100%
Complete computational species homology data:
Anti-MESP1 (ARP35960_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAME
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MESP1 (ARP35960_P050) antibody is Catalog # AAP35960 (Previous Catalog # AAPP07218)
Datasheets/Manuals:
Printable datasheet for anti-MESP1 (ARP35960_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...