Melk Antibody - N-terminal region (ARP46208_P050)

Catalog No: ARP46208_P050

Host: Rabbit
Target Name: Melk
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Melk
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GFAKVKLACHVLTGEMVAIKIMDKNALGSDLPRVKTEIDALKSLRHQHIC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Melk (ARP46208_P050) antibody is Catalog # AAP46208

Target Info

• Gene Symbol: Melk
• Gene Full Name: maternal embryonic leucine zipper kinase
• Alias Symbols: MPK3, MPK38, AI327312, mKIAA0175
• NCBI Gene Id: 17279
• Protein Name: Maternal embryonic leucine zipper kinase
• Description of Target: Melk is a Serine/threonine-protein kinase involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. Has a broad substrate specificity; phosphorylates BCL2L14, CDC25B, MAP3K5/ASK1 and ZNF622. Acts as an activator of apoptosis by phosphorylating and activating MAP3K5/ASK1. Melk Acts as a regulator of cell cycle, notably by mediating phosphorylation of CDC25B, promoting localization of CDC25B to the centrosome and the spindle poles during mitosis. It Plays a key role in cell proliferation. It is required for proliferation of embryonic and postnatal multipotent neural progenitors. Phosphorylates and inhibits BCL2L14. It's also involved in the inhibition of spliceosome assembly during mitosis by phosphorylating ZNF622, thereby contributing to its redirection to the nucleus and may also play a role in primitive hematopoiesis.
• Uniprot ID: Q61846
• Protein Accession #: NP_034920
• Nucleotide Accession #: NM_010790
• Protein Size (# AA): 643
• Molecular Weight: 70kDa
• Protein Interactions: Txn1; ZNF622; UBC; TXN; TP53; MAP3K5; MDM2; SMAD7; SMAD3;