Search Antibody, Protein, and ELISA Kit Solutions

MEIS2 Antibody - N-terminal region (ARP34684_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34684_T100-FITC Conjugated

ARP34684_T100-HRP Conjugated

ARP34684_T100-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Meis homeobox 2
NCBI Gene Id:
Protein Name:
Homeobox protein Meis2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MRG1, HsT18361
Replacement Item:
This antibody may replace item sc-101850, HPA003256
Description of Target:
MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MEIS2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MEIS2.
The immunogen is a synthetic peptide directed towards the N terminal region of human MEIS2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MEIS2 (ARP34684_T100)
Peptide Sequence:
Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MEIS2 (ARP34684_T100) antibody is Catalog # AAP34684 (Previous Catalog # AAPP05874)
Printable datasheet for anti-MEIS2 (ARP34684_T100) antibody
This antibody will recognize both MEIS1 and MEIS2 isoforms
Target Reference:
Yang,Y., et al., (2000) J. Biol. Chem. 275 (27), 20734-20741

Jackson, B. et al. TALE homeodomain proteins regulate site-specific terminal differentiation, LCE genes and epidermal barrier. J. Cell Sci. 124, 1681-90 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21511732

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...