Size:100 ul
$229.00
In Stock
SKU
ARP34684_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP34684_T100-FITC Conjugated

ARP34684_T100-HRP Conjugated

ARP34684_T100-Biotin Conjugated

MEIS2 Antibody - N-terminal region (ARP34684_T100)

Catalog#: ARP34684_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-101850, HPA003256
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MEIS2
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-MEIS2 (ARP34684_T100)
Peptide Sequence Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MEIS2 (ARP34684_T100) antibody is Catalog # AAP34684 (Previous Catalog # AAPP05874)
Datasheets/Manuals Printable datasheet for anti-MEIS2 (ARP34684_T100) antibody
Specificity This antibody will recognize both MEIS1 and MEIS2 isoforms
Target Reference Yang,Y., et al., (2000) J. Biol. Chem. 275 (27), 20734-20741
Publications

Jackson, B. et al. TALE homeodomain proteins regulate site-specific terminal differentiation, LCE genes and epidermal barrier. J. Cell Sci. 124, 1681-90 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21511732

Gene Symbol MEIS2
Official Gene Full Name Meis homeobox 2
Alias Symbols MRG1, HsT18361
NCBI Gene Id 4212
Protein Name Homeobox protein Meis2
Description of Target MEIS2 encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs.
Swissprot Id O14770
Protein Accession # NP_733775
Nucleotide Accession # NM_170675
Protein Size (# AA) 477
Molecular Weight 52kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MEIS2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MEIS2.
Protein Interactions LINC00238; C1orf94; OSGIN1; MEIS2; ANXA1; CRBN; ARNT2; DGCR6; SQSTM1; SOX2; APP; SP1; PBX1; ZNHIT3; TRIM25; HOXA13; HOXA9;
  1. What is the species homology for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MEIS2 Antibody - N-terminal region (ARP34684_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    This target may also be called "MRG1, HsT18361" in publications.

  5. What is the shipping cost for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MEIS2 Antibody - N-terminal region (ARP34684_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MEIS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MEIS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MEIS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MEIS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MEIS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MEIS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MEIS2 Antibody - N-terminal region (ARP34684_T100)
Your Rating
We found other products you might like!