SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37342_T100-FITC
Size:100ul
Price: $384.00
SKU
ARP37342_T100-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)

Datasheets/ManualsPrintable datasheet for anti-MEF2C (ARP37342_T100-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
Concentration0.5 mg/ml
Blocking PeptideFor anti-MEF2C (ARP37342_T100-FITC) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440)
ReferenceShen,H., et al., (2006) Genes Dev. 20 (6), 675-688
Publications

Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 18772864

Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). IHC, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 19359597

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 20335662

Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). WB, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 21715356

Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). WB, ICC/IF, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 22931955

Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). WB, Pig, Human, Rat, Dog, Mouse, Rabbit, Bovine, Zebrafish, Horse 23706318

Gene SymbolMEF2C
Gene Full NameMyocyte enhancer factor 2C
Alias SymbolsMef2, AV011172, 5430401D19Rik, 9930028G15Rik
NCBI Gene Id17260
Protein NameMyocyte-specific enhancer factor 2C
Description of TargetMEF2C is a transcription regulator of slow fiber
Uniprot IDQ8CFN5-4
Protein Accession #NP_079558
Nucleotide Accession #NM_025282
Protein Size (# AA)432
Molecular Weight48kDa
Protein InteractionsVgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1;
  1. What is the species homology for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    This target may also be called "Mef2, AV011172, 5430401D19Rik, 9930028G15Rik" in publications.

  5. What is the shipping cost for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MEF2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MEF2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MEF2C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MEF2C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MEF2C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MEF2C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MEF2C Antibody - N-terminal region : FITC (ARP37342_T100-FITC)
Your Rating
We found other products you might like!