Size:100 ul
$229.00
In Stock
SKU
ARP37342_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37342_T100-FITC Conjugated

ARP37342_T100-HRP Conjugated

ARP37342_T100-Biotin Conjugated

MEF2C Antibody - N-terminal region (ARP37342_T100)

Catalog#: ARP37342_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-10794 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data Anti-MEF2C (ARP37342_T100)
Peptide Sequence Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MEF2C (ARP37342_T100) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440)
Datasheets/Manuals Printable datasheet for anti-MEF2C (ARP37342_T100) antibody
Target Reference Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688
Publications

Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21715356

Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22931955

Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23706318

Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 18772864

Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19359597

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20335662

Gene Symbol MEF2C
Official Gene Full Name Myocyte enhancer factor 2C
Alias Symbols Mef2, AV011172, 5430401D19Rik, 9930028G15Rik
NCBI Gene Id 17260
Protein Name Myocyte-specific enhancer factor 2C
Description of Target MEF2C is a transcription regulator of slow fiber
Swissprot Id Q8CFN5-4
Protein Accession # NP_079558
Nucleotide Accession # NM_025282
Protein Size (# AA) 432
Molecular Weight 48kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MEF2C.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MEF2C.
Protein Interactions Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1;
  1. What is the species homology for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MEF2C Antibody - N-terminal region (ARP37342_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    This target may also be called "Mef2, AV011172, 5430401D19Rik, 9930028G15Rik" in publications.

  5. What is the shipping cost for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MEF2C Antibody - N-terminal region (ARP37342_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MEF2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MEF2C"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MEF2C"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MEF2C"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MEF2C"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MEF2C"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MEF2C Antibody - N-terminal region (ARP37342_T100)
Your Rating
We found other products you might like!