Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MEF2C Antibody - N-terminal region (ARP37342_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37342_T100-FITC Conjugated

ARP37342_T100-HRP Conjugated

ARP37342_T100-Biotin Conjugated

Gene Symbol:
MEF2C
Official Gene Full Name:
Myocyte enhancer factor 2C
NCBI Gene Id:
17260
Protein Name:
Myocyte-specific enhancer factor 2C
Swissprot Id:
Q8CFN5-4
Protein Accession #:
NP_079558
Nucleotide Accession #:
NM_025282
Alias Symbols:
Mef2, AV011172, 5430401D19Rik, 9930028G15Rik
Replacement Item:
This antibody may replace item sc-10794 from Santa Cruz Biotechnology.
Description of Target:
MEF2C is a transcription regulator of slow fiber
Protein Size (# AA):
432
Molecular Weight:
48kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MEF2C.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MEF2C.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-MEF2C (ARP37342_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1;
Blocking Peptide:
For anti-MEF2C (ARP37342_T100) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440)
Datasheets/Manuals:
Printable datasheet for anti-MEF2C (ARP37342_T100) antibody
Target Reference:
Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688
Publications:

Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21715356

Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22931955

Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23706318

Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 18772864

Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19359597

Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20335662

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...