- Gene Symbol:
- MEF2C
- NCBI Gene Id:
- 17260
- Official Gene Full Name:
- Myocyte enhancer factor 2C
- Protein Name:
- Myocyte-specific enhancer factor 2C
- Swissprot Id:
- Q8CFN5-4
- Protein Accession #:
- NP_079558
- Nucleotide Accession #:
- NM_025282
- Alias Symbols:
- Mef2, AV011172, 5430401D19Rik, 9930028G15Rik
- Replacement Item:
- This antibody may replace item sc-10794 from Santa Cruz Biotechnology.
- Description of Target:
- MEF2C is a transcription regulator of slow fiber
- Protein Size (# AA):
- 432
- Molecular Weight:
- 48kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express MEF2C.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express MEF2C.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of mouse MEF2C
- Tested Species Reactivity:
- Human, Mouse
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
- Complete computational species homology data:
- Anti-MEF2C (ARP37342_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: SRTNSDIVEALNKKENKGSESPDPDSSYALTPRTEEKYKKINEEFDNMIK
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- Vgll2; Hdac4; Nkx2-5; Hdac5; Phb2; KDM1A; Carm1; Ifrd1; Ncoa3; Ncoa2; Foxh1;
- Blocking Peptide:
- For anti-MEF2C (ARP37342_T100) antibody is Catalog # AAP37342 (Previous Catalog # AAPP09440)
- Datasheets/Manuals:
- Printable datasheet for anti-MEF2C (ARP37342_T100) antibody
- Target Reference:
- Shen,H., et al., (2006) Genes Dev. 20 (6), 675-688
- Publications:
Leschik, J., Stefanovic, S., Brinon, B. & Pucéat, M. Cardiac commitment of primate embryonic stem cells. Nat. Protoc. 3, 1381-7 (2008). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 18772864
Lombardi, R. et al. Genetic fate mapping identifies second heart field progenitor cells as a source of adipocytes in arrhythmogenic right ventricular cardiomyopathy. Circ. Res. 104, 1076-84 (2009). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 19359597
Tennis, M. A. et al. Prostacyclin inhibits non-small cell lung cancer growth by a frizzled 9-dependent pathway that is blocked by secreted frizzled-related protein 1. Neoplasia 12, 244-53 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 20335662
Escher, P., Schorderet, D. F. & Cottet, S. Altered expression of the transcription factor Mef2c during retinal degeneration in Rpe65-/- mice. Invest. Ophthalmol. Vis. Sci. 52, 5933-40 (2011). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 21715356
Inagawa, K. et al. Induction of cardiomyocyte-like cells in infarct hearts by gene transfer of Gata4, Mef2c, and Tbx5. Circ. Res. 111, 1147-56 (2012). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 22931955
Law, S. K. et al. Regulation of multiple transcription factors by reactive oxygen species and effects of pro-inflammatory cytokines released during myocardial infarction on cardiac differentiation of embryonic stem cells. Int. J. Cardiol. 168, 3458-72 (2013). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23706318
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
