Search Antibody, Protein, and ELISA Kit Solutions

MED7 Antibody - C-terminal region (ARP38446_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP38446_P050-FITC Conjugated

ARP38446_P050-HRP Conjugated

ARP38446_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101188 from Santa Cruz Biotechnology.
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-MED7 (ARP38446_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIE
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED7 (ARP38446_P050) antibody is Catalog # AAP38446
Datasheets/Manuals:
Printable datasheet for anti-MED7 (ARP38446_P050) antibody
Subunit:
7
Gene Symbol:
MED7
Official Gene Full Name:
Mediator complex subunit 7
Alias Symbols:
CRSP33, CRSP9, MGC12284, ARC34
NCBI Gene Id:
9443
Protein Name:
Mediator of RNA polymerase II transcription subunit 7
Description of Target:
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.
Swissprot Id:
O43513
Protein Accession #:
NP_004261
Nucleotide Accession #:
NM_004270
Protein Size (# AA):
233
Molecular Weight:
27kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED7.
Protein Interactions:
HAUS1; CDK8; CDK19; MED13; MED19; MED26; EPAS1; MED6; UBE2I; UL48; SUMO2; UBC; CTDP1; MED10; MED25; MED15; MED14; VDR; SREBF1; RELA; PARP1; ZSCAN1; TRIM15; RHOXF2; PCBD2; MED31; TRIM29; RBFOX2; IKBKG; LZTR1; PML; MED9; MED8; HGS; MED1; HNF4A; ESR2; ESR1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...