Search Antibody, Protein, and ELISA Kit Solutions

MED6 Antibody - middle region (ARP34220_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP34220_P050-FITC Conjugated

ARP34220_P050-HRP Conjugated

ARP34220_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-134384 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MED6
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-MED6 (ARP34220_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED6 (ARP34220_P050) antibody is Catalog # AAP34220 (Previous Catalog # AAPP05535)
Datasheets/Manuals:
Printable datasheet for anti-MED6 (ARP34220_P050) antibody
Sample Type Confirmation:

MED6 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Subunit:
6
Target Reference:
Pavri,R., (2005) Mol. Cell 18 (1), 83-96
Gene Symbol:
MED6
Official Gene Full Name:
mediator complex subunit 6
Alias Symbols:
ARC33, NY-REN-28
NCBI Gene Id:
10001
Protein Name:
mediator of RNA polymerase II transcription subunit 6
Swissprot Id:
O75586
Protein Accession #:
NP_005457
Nucleotide Accession #:
NM_005466
Protein Size (# AA):
246
Molecular Weight:
28kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED6.
Protein Interactions:
TARDBP; UBC; CDK19; CDK8; MED10; MED23; CCNC; MED19; MED26; FBXW7; MED11; MED28; MED29; MED4; MED12; MED7; MED21; MED1; SMARCA4; BCL6; SUZ12; CUL1; SKP1; CTDP1; MED25; SREBF1; MED15; VDR; OBFC1; MED18; ZC3H13; TADA2A; RARA; PARP1; SMAD3; SMAD2; SMAD1; MED

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...