Search Antibody, Protein, and ELISA Kit Solutions

MED31 Antibody - N-terminal region (ARP56820_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56820_P050-FITC Conjugated

ARP56820_P050-HRP Conjugated

ARP56820_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-101189 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MED31
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MED31 (ARP56820_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MED31 (ARP56820_P050) antibody is Catalog # AAP56820 (Previous Catalog # AAPP39729)
Datasheets/Manuals:
Printable datasheet for anti-MED31 (ARP56820_P050) antibody
Subunit:
31
Target Reference:
Cavdar (er) World J Surg (2008) In press
Gene Symbol:
MED31
Official Gene Full Name:
Mediator complex subunit 31
Alias Symbols:
3110004H13Rik, CGI-125, FLJ27436, FLJ36714, Soh1
NCBI Gene Id:
51003
Protein Name:
Mediator of RNA polymerase II transcription subunit 31
Description of Target:
MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal
Swissprot Id:
Q9Y3C7
Protein Accession #:
NP_057144
Nucleotide Accession #:
NM_016055
Protein Size (# AA):
131
Molecular Weight:
16kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MED31.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MED31.
Protein Interactions:
UBC; CDK19; CDK8; MED19; MED26; FBXW7; GADD45G; FAM118B; DAZAP2; SELENBP1; TK1; SMN1; NR4A1; CDKN1A; ANXA7; HTT; MED28; MED18; MED12; QKI; TADA2A; ZSCAN1; MED7; HGH1; ASCC2; ZBTB45; RBM23; MED9; EEF1G; PMF1; HNRNPUL1; MOB4; ORAI2; HSPB1; CACNB4; ERH; C2or

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...